KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0038Help
Entry
YPTS_0038         CDS       T00744                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ypb00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(44728..45351)
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKRPGENHGEHYFFVSEK
EFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDIDWQGAQQIRAKMPTARS
IFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVAEMAHYAEYDYLIVNDDFNLALSDLK
TIIRAERLRLGRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaggtacgctatacatagtttccgcgcccagcggggcagggaaatcaagcctg
attcaggctttgttaaaaacacaaccgctgtacgacacgcaggtttcaatttcccatacc
acgcgtgctaaacgtccaggggagaatcacggcgagcattacttctttgtttctgaaaaa
gagttttgccagatgattgatgatgatgctttccttgagcatgccaaagtatttgaaaat
tactacggtacctcacgtctggctattgagcaggttcttgcaaccggggttgatgtcttt
ttagatattgactggcaaggagcgcaacagattcgcgcaaaaatgccaaccgctcgcagt
attttcatcttgccgccatccaaaacagaattggatcgccgtttacgcggtcgtgggcag
gatagcgaagaagttatcgctaagcgtatggagcaagctgtcgcagagatggctcattac
gcagagtatgattatttaatcgtaaatgatgatttcaatctggctttgtctgatctgaaa
accattattcgcgcagaacgactgcgtttaggccgccagaaacagcggcatgacgcttta
atcagcaaattattggcggactga

DBGET integrated database retrieval system