KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0090Help
Entry
YPTS_0090         CDS       T00744                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    YPTS_0090
Enzymes [BR:ypb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     YPTS_0090
Exosome [BR:ypb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YPTS_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(92967..94490)
Genome map
AA seq 507 aa AA seqDB search
MTTENTTQKKYIVALDQGTTSSRAVVLDHNANIVSVSQREFTQIYPKAGWVEHDPMEIWA
TQSSTLIEVLAKAGINSDEIAGIGITNQRETTIVWDKVTGKPVYNAIVWQCRRTADICEK
LKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARERAERGELLFGTVDTWLVWNMT
QGRVHVTDYTNASRTMMFNIRTKEWDDRMLKALNIPRAMLPEVRPSSEIYGKTNIGGKGG
TRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNTGEEAVQSTHGLLTTIACGP
RGEVNYALEGAVFIGGASIQWLRDELKLIGDATDSEYFATKVKNSNGVYVVPAFTGLGAP
YWDPYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGARLKSLRVDGGAVA
NNFLMQFQADILGTRVERPAIRESTALGAAFLAGLATGFWDDLDEVKSKASIEREFRPGI
ETTERDIRYKGWKKAVARARDWEEHDE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaaatactactcaaaaaaaatacattgtcgcacttgatcaggggacaacc
agctccagggcggtagtactggatcacaatgcaaatatcgtgagtgtttctcagcgtgaa
ttcactcagatttacccaaaggctggctgggttgagcatgacccaatggagatctgggcg
acccaaagctctacactgattgaagtcctggccaaagccggtatcaactctgatgaaatc
gcgggtatcggtattaccaatcagcgcgaaaccacgattgtttgggataaagtgaccggt
aagccggtgtataacgccattgtctggcaatgccgccgtactgcggatatttgcgaaaaa
ctgaaaaaagaagggctggaagagtatatccgccacaacaccggtttggtggtagatccc
tacttctctggcacaaaagtgaaatggatcctcgataacgtcgagggcgctcgcgagcgc
gctgaacgcggtgagttactgtttggtaccgtagacacctggctggtgtggaatatgacg
caaggccgtgtgcacgtcaccgactataccaacgcatcacggaccatgatgtttaacatc
cgtaccaaggagtgggacgaccgtatgctgaaagcgctgaatattccacgcgccatgcta
ccggaagttcgcccatcctccgaaatctacggcaaaaccaatatcggtggcaaaggtggc
actcgtattccaatcgccgggattgccggtgaccagcaagccgctctgtttggtcagctt
tgtgtacagccgggcatggcaaaaaatacctacggtacgggttgcttcctgctgatgaac
accggtgaagaagcggttcaatctactcatggcctgttgaccaccattgcctgtggccca
cgcggtgaagtgaattatgcactggaaggggctgtatttattggtggtgcctccattcaa
tggctacgtgatgaattgaagttgataggcgatgccaccgattctgagtatttcgcgacc
aaagtgaaaaacagtaatggtgtgtatgtggtaccagcgttcaccggtctgggcgctcct
tactgggacccgtatgcccgtggtgcgattttcggcctgacccgtggtgttaacagcaac
cacattatccgtgcaacgctcgaatccatagcttatcagacccgcgatgtcttggatgcc
atgcaagctgactccggcgcacggctgaaatcactgcgtgttgatggcggtgcagtagct
aataacttcctgatgcagttccaggccgatattctgggtacccgtgttgagcgccctgct
attcgtgaaagtacagcattgggtgctgcattcctggcaggtctggcgacgggcttctgg
gatgacctcgatgaggtgaagagtaaagcaagcattgaacgcgaattccgtccagggatt
gaaaccacagagcgtgatatccgttacaagggctggaaaaaagcagtggcccgcgcccgg
gattgggaagagcacgacgagtaa

DBGET integrated database retrieval system