KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0220Help
Entry
YPTS_0220         CDS       T00744                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ypb00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
240349..241344
Genome map
AA seq 331 aa AA seqDB search
MNNWLTREEQFAAFINGPLLDFWQQRDEQTFMGVDNIPIRYVRFRAPHHTQVVVVVPGRI
ESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRMLDDHNRGHVIKFDDYIEDFAQLVQIE
ITGSHYQQRFALAHSMGGAILTRFLAREPDVFNAVALCAPMFGIHLPLPGWLARRIVNWA
EGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRERYRRYLRQYSDTPEIRVGGPTYHWLRES
LLVGEQIIAEAEKITTPVLLLQASEDRVVHNPAHDAFSQAMTLAGHPCEGGRPQVIQGAR
HEILFERDTLRAEALSAILRFFAQHQSSVGH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaataattggttaacccgagaagagcaatttgctgcttttattaatgggccattgttg
gatttctggcagcaacgagacgaacagacgtttatgggcgtcgataatatccccattcgc
tatgtccgttttcgtgcgccgcatcatacccaagtcgtggtggtagtgccggggcgtatc
gaaagttacgtcaaataccctgaagttgcttatgacctgttccagcagggctatgatgtg
atagtgctggatcatcgcgggcaagggcgttctgggcgtatgctggatgatcataaccgt
ggtcacgtgattaagttcgatgactatattgaggattttgcacaactggtgcagatcgaa
attaccggtagccattatcagcagcgttttgcgctggcccactcaatggggggcgcgatt
ctgacgcgttttctagccagagagcctgatgtatttaatgccgttgcgttatgtgcgccc
atgtttggtattcatttacccctgccgggctggttggcacgccgtattgttaactgggcc
gaagggcaccaaaagctacgggattattacgcgattggtactgggcattggcggccactg
ccgtatttggtcaatatgctgactcacagccgcgagcgttatcgccgctatttgcgccaa
tattcagacacaccagaaatccgcgtgggtggccccacttaccattggctacgtgaaagt
ttgctggtgggggagcaaattattgctgaagcggagaaaatcaccactccggtattattg
ttacaggccagtgaggatcgggtggttcataacccagcccacgatgctttttctcaggca
atgacattggcagggcacccctgtgaaggggggcgtcctcaggtcattcaaggcgcacgc
catgagatcctgtttgagcgggacacgctgcgtgccgaggcgcttagcgccatattgcgc
tttttcgcgcaacatcaatcatcagtcggccattag

DBGET integrated database retrieval system