KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0256Help
Entry
YPTS_0256         CDS       T00744                                 

Definition
glycerol-3-phosphate transporter membrane protein
Orthology
K05815  
sn-glycerol 3-phosphate transport system permease protein
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ypb02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
278336..279181
Genome map
AA seq 281 aa AA seqDB search
MIENRRGLDIFCHIMLIIGGLLILFPLYVAFVAASLDDSQVFQAPMTLIPGPHLWQNISH
IWHAGVGNNSTPFGLMLLNSFVMAFAITVGKITVSILSAYAIVYFRFPLRNLFFWLIFLT
LMLPVEVRIFPTIEVIANLNLLDSYTGLTLPLMASATATFLFRQFFMTLPDELLEAARID
GAGAMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWPILITSDASMGTAVAGIRSMIST
SGAPTQWNQVMAAMILTLIPPVVVVLLMQRWFVRGLVDSEK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagaatcgtcgtggattggatatcttttgtcacatcatgctgattatcgggggg
ctattgatcctgttcccactgtatgtggcgttcgttgcggcttcattagatgacagccag
gtttttcaggcgcccatgacgctgatccctggcccgcatttgtggcaaaacatcagccat
atctggcatgccggcgtgggcaataacagcacacctttcgggttgatgctgttgaacagt
tttgttatggcttttgccattactgtcggcaaaatcactgtctcaatattgtctgcttat
gccatcgtttacttccgtttcccactgcggaatctgtttttctggctaatcttcctcacg
ctgatgctaccggtggaagtgcgtattttccctaccattgaggtgattgccaacctgaac
ctgctagacagctataccggtttaacattgccgctgatggcctctgccacggcgacgttc
ttattccgccagttctttatgacgttgccggatgagctattggaagccgcccgtattgac
ggcgccggtgccatgcgtttcttctgggacattgtattaccgctgtcaaaaaccaatctc
gcagcattatttgttattacctttatttatggctggaaccaatacctttggccgatctta
atcaccagtgatgcctcaatgggcacggcagtggcggggataagaagcatgatttcaacc
tcgggcgcaccaacccaatggaatcaggttatggcggcgatgattttgactttaattcca
ccggtcgtggtggttcttttgatgcagcgttggtttgtacgcggcttggtagacagtgag
aagtaa

DBGET integrated database retrieval system