KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0256Help
Entry
YPTS_0256         CDS       T00744                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K05815  sn-glycerol 3-phosphate transport system permease protein
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    YPTS_0256
Transporters [BR:ypb02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    YPTS_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACC87251
JGI: YPTS0256
Position
278336..279181
Genome map
AA seq 281 aa AA seqDB search
MIENRRGLDIFCHIMLIIGGLLILFPLYVAFVAASLDDSQVFQAPMTLIPGPHLWQNISH
IWHAGVGNNSTPFGLMLLNSFVMAFAITVGKITVSILSAYAIVYFRFPLRNLFFWLIFLT
LMLPVEVRIFPTIEVIANLNLLDSYTGLTLPLMASATATFLFRQFFMTLPDELLEAARID
GAGAMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWPILITSDASMGTAVAGIRSMIST
SGAPTQWNQVMAAMILTLIPPVVVVLLMQRWFVRGLVDSEK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagaatcgtcgtggattggatatcttttgtcacatcatgctgattatcgggggg
ctattgatcctgttcccactgtatgtggcgttcgttgcggcttcattagatgacagccag
gtttttcaggcgcccatgacgctgatccctggcccgcatttgtggcaaaacatcagccat
atctggcatgccggcgtgggcaataacagcacacctttcgggttgatgctgttgaacagt
tttgttatggcttttgccattactgtcggcaaaatcactgtctcaatattgtctgcttat
gccatcgtttacttccgtttcccactgcggaatctgtttttctggctaatcttcctcacg
ctgatgctaccggtggaagtgcgtattttccctaccattgaggtgattgccaacctgaac
ctgctagacagctataccggtttaacattgccgctgatggcctctgccacggcgacgttc
ttattccgccagttctttatgacgttgccggatgagctattggaagccgcccgtattgac
ggcgccggtgccatgcgtttcttctgggacattgtattaccgctgtcaaaaaccaatctc
gcagcattatttgttattacctttatttatggctggaaccaatacctttggccgatctta
atcaccagtgatgcctcaatgggcacggcagtggcggggataagaagcatgatttcaacc
tcgggcgcaccaacccaatggaatcaggttatggcggcgatgattttgactttaattcca
ccggtcgtggtggttcttttgatgcagcgttggtttgtacgcggcttggtagacagtgag
aagtaa

DBGET integrated database retrieval system