KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0332Help
Entry
YPTS_0332         CDS       T00744                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00010  Glycolysis / Gluconeogenesis
ypb00620  Pyruvate metabolism
ypb00640  Propanoate metabolism
ypb00680  Methane metabolism
ypb01100  Metabolic pathways
ypb01110  Biosynthesis of secondary metabolites
ypb01120  Microbial metabolism in diverse environments
ypb01130  Biosynthesis of antibiotics
ypb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPTS_0332
   00620 Pyruvate metabolism
    YPTS_0332
   00640 Propanoate metabolism
    YPTS_0332
  Energy metabolism
   00680 Methane metabolism
    YPTS_0332
Enzymes [BR:ypb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YPTS_0332
Lipid biosynthesis proteins [BR:ypb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YPTS_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACC87321
JGI: YPTS0332
Position
complement(367251..369209)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGKIIDWIKPYKTVKNTSF
DPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPNQSKTVTYKQLHHDVCQF
ANVLKSLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHS
KLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWHDL
IKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTA
IRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPGQARTLFGD
HDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLATPDILHWTD
SLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacataaacatcctattccagctgcaattgcagagcatgctctaattacc
ccagaaaaataccaacattattaccaacaatcagtgcagaaccctgatgaattctggggc
gaacaaggcaaaatcattgattggattaaaccctataaaacggtaaaaaatacctccttt
gaccccggtcatgtgagtatccgctggtttgaggacggtacattgaacctcgcggcgaat
tgccttgatcgccatttggcagagcgtggtgatcaaacagccatcatttgggaaggtgat
gaccctaatcaatcaaaaaccgtcacttataagcaactgcaccatgatgtgtgccagttt
gctaatgtcctaaaaagtttaggcatcaaaaaaggcgatgtagttgccatctatatgcca
atggtgcctgaagctgccgtggcgatgttggcttgcgcgcgcattggcgctgttcattcc
gttatctttggtggattttctccagatgccgttgccgggcgtatcatcgattctcactct
aaactggtgattactgccgatgaaggtatccgtgcaggccgtgctattccactgaaaaaa
aatgttgatgaagcactgaaaaaccccgctatcaccagtattaaaaatgttgtggtcttc
caacgtactggtaacgccagctattgggaagatgggcgcgatgtatggtggcatgacctg
ataaaagaggcatccgctgactgcccgccagaagagatgaatgcagaagacccgctgttc
atcctttatacctctggctctaccggtaaacctaaaggggttgtacatacgacgggcggt
tatctggtttacgctgcactgacattcaaatatgtttttgattatcaccctggcgatatc
tactggtgtactgcagacgttggctgggtaaccgggcacagttatctattatatggacca
ctggcttgtggggccatcactctaatgtttgaaggcgtgcctaactaccctggcgtcaat
cgcttgagccaggttgttgataaacataaagtcaatattctatacaccgcgcctacagcg
attcgggccttaatggccgaaggtgacaaagccatcgaaggaaccaaacgcgactcactg
cgtattatggggtcggtcggcgaaccgattaacccagaagcctgggaatggtattacaac
aagatcggtaacagtaaatgcccgattgtcgatacctggtggcagactgaaaccggtggt
ttcatgataacccctctgccgggtgccaccgagttgaaagccggttccgcaactcgtcca
ttctttggagtacaacctgcgttggtagataacctgggcaatcctcaggaaggggtggca
gaaggtaatctggtcataaccgactcatggccggggcaagccagaacattatttggcgat
catgaccgtttcgagcaaacctacttctcaacctttaaaggcatgtatttcagtggcgac
ggcgcacgtcgtgacgaagacggttactactggataaccggtcgagtcgatgacgtacta
aacgtttcaggccatcgcttaggaacggctgaaattgaatctgcactggttgcacacccg
aaaattgccgaagcggctgttgtcggtgttccacataatattaaaggacaggctatttat
gcctatatcacgctaaatcacggtgaagaaccaactccagagttatataccgaagtacgc
aactgggtacgtaaagagattggcccacttgcaacacccgatattttgcattggacggac
tcattacccaaaacccgttcaggcaaaatcatgcgccgtattttacgcaaaattgcgaca
ggagataccagcaacttgggcgatacctcaacacttgccgatccaagcgtggtagaaaaa
ttactagaagaaaaacaatcaatgcagacaccgtcgtaa

DBGET integrated database retrieval system