KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0604Help
Entry
YPTS_0604         CDS       T00744                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ypb00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
667792..669207
Genome map
AA seq 471 aa AA seqDB search
MHCRLKACRVAISESACGRLSSHIQVKQGDALFLAQEIIRKKRDGQPLSEEEIRFFINGI
RDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLNWKSLNLNGPLVDKHSTGG
VGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFRKIIQNV
GVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGA
FMPTYSLSADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGEYRN
PRLLEVTMALCVEMLLSGGLAHDEADARAKLQAVLDNGKAAEVFGRMVAAQKGPVDFVER
YDSYLPVATLSKPVFAEQTGIITAMDTRALGMAVVALGGGRRRATDPIDYSVGLTEMARL
GTRVDGQQPLAVIHANNEDDWQQAAEAVRAAITLGNNAPEETPVIYRRITE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcactgtaggctgaaggcctgccgtgtcgctatttccgaaagcgcctgtgggcggctt
tcatcccatattcaggtcaagcagggggatgccttgtttctggcacaagaaattatccgt
aaaaaacgcgacggtcagccattgagcgaagaagagattcgtttttttatcaatgggatc
cgcgataacgttgtttctgaagggcaaattgccgctttagcgatgaccatttatttccac
gatatgagtatgcctgagcgcgttgcgctgaccatggcgatgcgtgattccggtactgtg
ctgaattggaagagcctgaatctgaatggcccgctggtcgataagcactccactggtggc
gtgggtgatgtgacgtcactgatgcttggcccgatggtggcagcttgcggcggttatgtg
ccgatgatctctggccgtggtcttggtcataccggcggcacactggataaactggaggcg
atccccggttttgatattttcccggatgataatgcgttccgcaaaattattcagaatgtt
ggtgtggcgattatcggccaaaccagctcgctggcccctgccgataagcgtttttacgcg
acccgcgatattacggcaacagttgattctattccattgattacggcctctatcctggcc
aaaaaattggcggaagggctggatgcattggtcatggacgtgaaggtcggctccggtgcc
tttatgccaacctactcgttgtcggctgatttggcgcaggcgattgttggtgtggcaaac
ggggcgggttgcaaaaccacggcgctcctgacggacatgaaccaagtcctggcatccagc
gccggtaatggggtcgaagtccgcgaagctgtgcgtttcctgacgggcgaatatcgcaac
ccacgtttgctggaagtgactatggcgctgtgtgttgaaatgttgctgtcaggcggttta
gcgcacgatgaagccgatgcccgtgccaagctgcaagccgttttggataacggcaaagcg
gcagaagtctttggccgcatggtggccgcgcaaaaaggcccggtagactttgttgaacgc
tatgacagctacctgcccgttgctaccctaagcaaaccggtatttgctgaacagacggga
atcattactgcaatggatacccgcgccttgggtatggcggtggtcgccctcggcggggga
cgccgtcgggcaacggatcccattgattatagtgtagggctgacggaaatggcccgcttg
ggtacccgtgttgacgggcagcagccacttgcggtgatccatgccaataacgaagatgac
tggcaacaggcggcagaggctgtgcgtgcggccatcaccttagggaataacgcgccagaa
gaaacgccagtgatttatcgccgtatcactgaataa

DBGET integrated database retrieval system