KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0641Help
Entry
YPTS_0641         CDS       T00744                                 

Gene name
ileS
Definition
isoleucyl-tRNA synthetase
Orthology
K01870  
isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ypb00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
714516..717332
Genome map
AA seq 938 aa AA seqDB search
MSDYKNTLNLPETGFPMRGDLAKREPDMLKRWYEQDLYGIIRAAKKGKKTFILHDGPPYA
NGNIHIGHSVNKILKDIIVKSKGMAGYDSPYIPGWDCHGLPIELKVEQLIGKPGEKVSAA
EFRTACRKYAAEQVEGQKKDFIRLGVLGDWDHPYLTMDFKTEANIIRALSKIIDNGHLHK
GAKPVHWCTDCGSSLAEAEVEYYDKTSQSIDVRFNAVDTATVAAKFGVSAVNGPISLVIW
TTTPWTLPANRAISLNAEYLYQLVQVEGECLILAADLVESVMKRAGITQWAVLGSCTGSD
LELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGPDDFVIGQKYGLEVANPVGPN
GCYLAGTYPTLDGLFVFKANDVVVELLREKGALLHVEKLLHSYPCCWRHKTPIIFRATPQ
WFISMDQKGLRKQSLQEIKGVQWIPDWGQARIETMVANRPDWCISRQRTWGVPMSLFVHK
ETEQLHPRSIELMEEVAKRVEQDGIQAWWDLDPAEILGADAADYVKVPDTLDVWFDSGST
HSSVVDVRPEFGGHSPDMYLEGSDQHRGWFMSSLMIATAMKGKAPYRQVLTHGFTVDGQG
RKMSKSIGNTISPQDVMNKLGGDILRLWVASTDYTGEIAVSDEILKRSADSYRRIRNTAR
FLLANLNGFDPAQHQVKPEEMVVVDRWAVGRAQAAQAEIMEAYENYDFHLVVQRLMQFCS
VEMGSFYLDIIKDRQYTAKGDGIARRSCQTALFHIAEALVRWMAPIMSFTADEIWNHLPG
ERQQYVFTEEWYDGLFGLAGNESMNDTFWAELLKVRGEVNKVLEQARSDKRIGGSLEAAV
TLYAEPELAARLNSLQDELRFVLLTSAAKVAAYADAGNDAQQSELIAGLKITFNKADGEK
CPRCWHYTQDVGLVAEHAELCGRCVTNVAGDGEERKFA
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactacaagaataccctgaacttgcctgaaacagggttcccgatgcgcggcgat
ctggctaagcgtgaacctgacatgctgaaacgttggtatgagcaggatttatacgggatt
attcgtgcggccaagaaaggtaaaaagacctttattttgcacgatggccccccttatgcg
aacggcaacattcatattggtcactctgttaacaaaattctcaaagatattattgttaaa
tcaaaaggaatggctggatatgattcaccgtatatccccggttgggattgtcatggtttg
cctatcgagctaaaagttgaacaattaattggtaagccgggtgagaaagtcagcgctgca
gagttccggactgcttgccgtaaatatgccgctgagcaggttgaaggccagaagaaagat
tttattcgtctgggcgtgttgggtgattgggaccatccttacctaacgatggatttcaaa
actgaagccaatattatccgcgcattaagcaaaatcattgataacggtcatctgcataaa
ggtgccaaacctgtgcattggtgtaccgattgcggttcgtcgctggctgaagcagaagtt
gaatattacgataagacgtcacaatctattgatgtgcgttttaacgcggttgatacggca
actgttgcggccaaatttggtgtatctgctgttaacggcccaatctcactggttatctgg
actaccacgccatggactctgcctgctaaccgggctatttcactgaatgccgaatatctt
taccagttggttcaggttgagggcgagtgcctgattctggcagccgatctggttgagagc
gtcatgaagcgcgcgggcattactcagtgggccgtgttgggaagttgcacaggctccgat
ctggaactgttgcgctttacccatccctttatgggctttgatgttccagccattttaggt
gaccacgttacattggatgccggtaccggtgcggttcacaccgcgccaggtcacggcccg
gatgactttgttatcggccaaaaatatggcttagaagtggcgaaccctgtcggtccaaac
ggttgctatctggcgggtacgtatccaacgctggacggcctgtttgtgtttaaagccaac
gatgtggttgtcgagttgctgcgtgagaaaggcgcactgctgcacgttgaaaaactgctc
cacagctacccatgctgctggcgtcacaaaactcctattatcttccgtgcaacgccgcag
tggtttatcagcatggatcagaaggggttgcgtaagcagtcacttcaagaaatcaaaggc
gtgcaatggatcccggattggggtcaggcgcgtatcgaaaccatggtagcaaaccgccca
gactggtgtatctctcgtcagcgtacttggggtgtgccgatgtctctgttcgttcacaaa
gagaccgaacaacttcatccgcgcagtattgaactgatggaagaagtggccaaacgtgtt
gagcaagatggcattcaagcgtggtgggatctggatccggcagagattttaggtgccgat
gccgcagattatgtcaaagtgccagatacgctggacgtatggtttgactctggttccacc
cattcttcggtcgttgacgtccgccctgaatttggggggcatagcccggatatgtatctg
gaaggttctgaccagcaccgcggctggtttatgtcttcattgatgattgctacggcgatg
aaaggtaaagcgccttaccgtcaggttctgacccacggttttactgtggatggtcagggt
cgcaaaatgtccaaatccattggtaacaccatcagcccacaagatgtcatgaacaagctg
gggggtgacattctgcgcctatgggtggcatcaaccgactataccggtgagattgctgtt
tctgatgaaattctgaaacgctctgcggactcctatcgtcgtatccgtaataccgcacgc
ttcctattagctaacctgaacggctttgatcccgcacagcatcaagtgaaaccggaagag
atggttgtagtcgatcgctgggcggttggccgtgcgcaagcggctcaggcagaaattatg
gaagcgtatgagaattacgatttccatttggtagtgcaacggctgatgcagttttgctcg
gttgagatgggatccttctatctggatatcattaaagaccgtcagtacaccgcgaaaggt
gacggcattgcacgtcgtagctgccagacagcactgttccatattgccgaggcgttggtg
cgctggatggccccaatcatgtccttcactgcggatgaaatctggaatcatctgccgggc
gagcgtcaacaatatgtcttcactgaagaatggtatgacggtctgtttggtttggcgggc
aacgaaagtatgaatgatactttctgggctgaattgttgaaagtgcgcggcgaagtgaac
aaagtgttggagcaggcccgtagcgataaacgtattggtggctcattagaggccgcagtg
acgttatacgcagagcctgaactggctgctcgtttgaacagtttgcaagatgaattgcgc
tttgttctactgacttctgccgctaaagtggccgcttatgctgatgcgggcaatgatgct
cagcaaagtgaattaattgccgggttgaaaattacctttaataaggctgacggcgagaag
tgcccacgttgctggcattacacgcaagatgtcggtttggtagcagagcacgctgaactg
tgtgggcgctgtgtcactaacgttgctggtgatggtgaggagcgtaagttcgcctga

DBGET integrated database retrieval system