KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0744Help
Entry
YPTS_0744         CDS       T00744                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00010  Glycolysis / Gluconeogenesis
ypb00020  Citrate cycle (TCA cycle)
ypb00620  Pyruvate metabolism
ypb01100  Metabolic pathways
ypb01110  Biosynthesis of secondary metabolites
ypb01120  Microbial metabolism in diverse environments
ypb01130  Biosynthesis of antibiotics
ypb01200  Carbon metabolism
Module
ypb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPTS_0744
   00020 Citrate cycle (TCA cycle)
    YPTS_0744
   00620 Pyruvate metabolism
    YPTS_0744
Enzymes [BR:ypb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YPTS_0744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ACC87728
JGI: YPTS0744
Position
837934..839508
Genome map
AA seq 524 aa AA seqDB search
MSIEINVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDKVATGSLIMVFDATGAAAAPVKAEEKPAAPAQAAAPAASAAKNVEVPDIGDDEVEVT
EVMVKVGDKVDAEQSLITVEGDKASMEVPAPFAGVVKEIKISTGDKVKTGSLIMVFEVEG
AAPAAEAAPAQQAAPVAPAPAAAPAAKAESKGEFAENDAYVHATPVIRRLAREFGVNLAK
VKGTGRKGRILREDIQAYVKDAVKRAEAAPAAAGGGLPGMLPWPKVDFSKFGEIEEVELG
RIQKISGANLSRNWVMIPHVTQFDEADITEVEAFRKQQNIEAEKKKQDLKITPLVFLMKA
AAKALEEFPRFNSSISEDGQKLTLKKYINIGVAVDTPNGLVVPVFRDVNKKGIVELSREL
SVISKKARDGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNG
KEFAPRLMLPLSLSFDHRVIDGAAGARFAAYIATIMADIRRLVM
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagaaattaatgtaccagacatcggtgcagatgaagtggaagtcaccgaaatt
atggtgaaagtgggcgataccgttgaagcggaacagtcgctaatcaccgttgaaggcgat
aaagcttccatggaagttccttcacctcaggcgggcgtggttaaagagatcaaaattgcg
gttggcgataaagtggctaccggttctctgatcatggtcttcgacgctacgggtgccgct
gcggcaccggttaaagcagaagaaaaaccggcggcgcctgctcaggcagcggctccggca
gcctctgcggcgaaaaatgttgaagtgccagatatcggtgatgacgaagttgaagtgact
gaagtgatggtgaaagtgggcgataaagttgacgccgaacaatcactgattacggttgaa
ggcgacaaagcgtcgatggaagtgcccgcaccgtttgctggtgtcgtgaaagaaatcaaa
atcagtaccggcgacaaagtgaaaaccggctctctgattatggtcttcgaagttgaaggt
gcagcgccagcagcagaagcggctccggctcaacaagccgcacctgtcgcgccagcgcca
gccgccgcacctgccgccaaagcagaaagcaaaggcgagtttgccgagaatgacgcttac
gtgcatgccacgccggttatccgtcgtctggcgcgtgagttcggtgtgaacctggcgaag
gtgaaagggacaggccgtaagggccgtatcctgcgcgaagacattcaagcttacgtgaaa
gatgccgtgaaacgtgccgaagctgcaccagcagcggctggcggcggcctgccgggcatg
ttgccttggccaaaagttgatttcagtaaatttggtgaaatcgaagaagtcgaattgggc
cgtatccagaaaatttctggtgcgaacctgagccgtaactgggtcatgatcccacatgtg
acgcaattcgatgaagcggatatcactgaagttgaagccttccgtaagcaacagaacatc
gaagctgagaagaaaaaacaagacctgaaaatcaccccgctggtgttcctgatgaaggcc
gccgctaaagcactggaagaattcccacgctttaacagctccatttccgaagatggtcag
aaactgacgctgaagaaatacatcaatatcggtgtggcggttgatacgcctaacggcttg
gtagttccagtattccgtgacgtcaacaaaaagggtattgtcgagttgtctcgtgagcta
tctgtcatctccaagaaagcacgtgatggcaagctgacagcatctgacatgcaaggcggc
tgtttcactatctccagtctgggcggtatcggcggtacggcatttacgccaatcgtcaat
gcgccagaagtggctatcttgggtgtatcaaaatcatccatgaaacctgtctggaatggt
aaagagtttgctccacgcctgatgttaccgctgtctctgtccttcgatcaccgtgtgatt
gatggtgccgcgggtgcacgcttcgccgcgtatatcgctaccattatggcggatattcgc
cgtctggtgatgtaa

DBGET integrated database retrieval system