KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0917Help
Entry
YPTS_0917         CDS       T00744                                 

Definition
(GenBank) Acireductone dioxygenase ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00270  Cysteine and methionine metabolism
ypb01100  Metabolic pathways
Module
ypb_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YPTS_0917
Enzymes [BR:ypb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     YPTS_0917
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     YPTS_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ACC87898
JGI: YPTS0917
UniProt: B2K632
Position
1033690..1034232
Genome map
AA seq 180 aa AA seqDB search
MSGLTIFSDQQPEKPLWQSHNAEEIQQQLTAIGVRFERWQADCELGENPQPEAVIAAYQH
EIDRLVAENGYKSWDVISMRPDNPQREALREKFLSEHTHGEDEVRFFVEGSGLFCLHLNE
KVYQILCEKNDLLSVPADIPHWFDMGSAPNFTAIRVFDNPEGWIARSTGDNIADGYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcggattaacgatttttagcgaccagcagccagaaaaaccgttgtggcagagccat
aatgctgaagaaattcaacagcagttgacggctatcggggtgcgctttgagcgctggcag
gcagattgtgaactgggtgagaacccacagccagaggccgttattgcggcttatcagcat
gagattgatcggctggtggcagaaaatggctataagagctgggatgtgatcagtatgcgc
cccgataatcctcaacgtgaagcactgcgagagaaatttttatctgagcatacccacggc
gaagatgaagtgcgtttttttgttgaaggtagcgggctgttctgtttgcatctaaacgag
aaggtttaccagattctgtgcgaaaaaaatgatctgttatccgtcccggcggatatccct
cattggttcgatatggggtcggcacccaatttcacggctatccgcgtgttcgataacccg
gaaggctggatagcacgttctaccggcgataatattgccgacggctatcctcgcctcgcc
taa

DBGET integrated database retrieval system