KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_1037Help
Entry
YPTS_1037         CDS       T00744                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ypb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1175766..1176341
Genome map
AA seq 191 aa AA seqDB search
MEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEHCT
ICLNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGPGDIGLDLLEK
RLSTEAISEVILATNPTVEGDATANYIGQMCGQYGILASRIAHGVPVGGELEMVDGTTLS
HSLAGRNPIKY
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgttgcgttgtttaccgggtgttggcccgaaatcagcgcaacgtatggcattt
cagttattacagcgcgatcgtagtggtggaatgcgcctggcgcaggctctgacacgggca
atgtctgaaataggccattgtgcagattgtcgtacatttaccgagcaagagcactgcacc
atctgcttgaatccccgccgtcaacaaaatggtcaaatctgtgtggtcgaaagcccggca
gatatccatgccattgagcaaactggccagtttggcgggcgttattttgtgctgatgggg
catttatcaccgatggatggtattggccctggtgatatagggctagatctactggagaaa
cggctttctactgaggctatcagtgaggtcattttagccacgaatccaaccgttgaaggg
gatgcaacagccaactatatcggccagatgtgtggccaatatggcatactggccagccgc
atcgcccatggcgttcctgttggtggcgagttagaaatggttgatggcaccacgttatct
cactcgttagcagggcgtaatcccatcaagtactga

DBGET integrated database retrieval system