KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_1076Help
Entry
YPTS_1076         CDS       T00744                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YPTS_1076
Enzymes [BR:ypb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YPTS_1076
   3.1.2  Thioester hydrolases
    3.1.2.-  
     YPTS_1076
Lipid biosynthesis proteins [BR:ypb01004]
 Fatty acid synthase
  Component type
   YPTS_1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1217705..1218277)
Genome map
AA seq 190 aa AA seqDB search
MRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQATPSLPKVVNASISGDTAAQGLA
RLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDLSEIINQITAAKAQPLLMQIRIPPN
YGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEWMQDDGLHPNGDAQPFIADWMAQ
QLKPLVVDPK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgccggttac
cgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagccacgcct
tcgttaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaagggctggcg
cgcttacccgccctactcaagcaacatcagccacgctgggtgctgattgaactgggtgcc
aatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatctgagcgaaattatc
aatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattccccccaac
tatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaacagttc
gacatccccctactccctttttttatggaacaggttgccgttaagccagagtggatgcag
gatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatggcgcaa
caactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system