KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_1076Help
Entry
YPTS_1076         CDS       T00744                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ypb01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1217705..1218277)
Genome map
AA seq 190 aa AA seqDB search
MRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQATPSLPKVVNASISGDTAAQGLA
RLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDLSEIINQITAAKAQPLLMQIRIPPN
YGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEWMQDDGLHPNGDAQPFIADWMAQ
QLKPLVVDPK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgccggttac
cgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagccacgcct
tcgttaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaagggctggcg
cgcttacccgccctactcaagcaacatcagccacgctgggtgctgattgaactgggtgcc
aatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatctgagcgaaattatc
aatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattccccccaac
tatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaacagttc
gacatccccctactccctttttttatggaacaggttgccgttaagccagagtggatgcag
gatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatggcgcaa
caactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system