KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_1181Help
Entry
YPTS_1181         CDS       T00744                                 

Definition
glycoside hydrolase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YPTS_1181
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    YPTS_1181
Enzymes [BR:ypb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YPTS_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1331372..1334047
Genome map
AA seq 891 aa AA seqDB search
MNKFKLNALAAITATFGLIGYANGSATNQQVVDQLSTLKVNYKLLDNRAADNGVDCAKLG
ADWASCNKVMITLTNTGDEIKGQDWAIYFHSIRMILAVDNDQFTVTHLTGDLHKIEPTAK
FAGFPANQTIEIPITGEYWQLFATDFMPRWYATSGDAKPKVLASTDTEDINAYLTPFTGD
QWKRTKDDNNVLMTPESRFVKNEAVKTLSAANLRGQIIPTPLDVKVYPQDADLSLGVALE
LSALPKPASDAIQQRFELLGLALSATGYPIKTVIQPTAFNGDHAVSGAYELKIGEKGAEV
IGFDQVGVFYGLQSILSLVPIEGSKTIATLDAKDAPRFDYRGVSLDVGRNFKTKAAVLRL
LDQMSAYKLNKFHFHLSDDEGWRIEIPGLPELTDVGSQRCHDLTETTCLLPQLGSGPESN
NLGSGYFTRADYIDILKYAKARQIDVIPEIDIPAHARAAVVSMEARYNNLMKQGKEKEAN
EFRLVDPTDDSNTTSVQFYERKSYLNPCLDSSKHFVDKVIGEMAQMHKEAGMPLTTWHFG
GDEAKNIRLGAGYQDKNGKIEPGKGIIDMRVEDKPWAKSQVCQDMVKQGKVQDIAHLSSY
FAIEVSKLVNAHGIEKMQAWQDGLRDAKDASAFATKRVGVNFWDTLYWGGADSVNDWANK
GYEVIASNPDYVYFDMPYEVNPSERGYYWATRFSDEAKVFSFAPDNMPQNAETSVDRDGN
HFSAKSDKPWPGVQGISGQSWNETVRTDEQMEYMAFPRVLPLAERAWHRASWEQEYKAGR
EYKGGETQWVDTQALSTDWQRFANIMGQRELAKLDKAGVAYRLPVPGARVVAGQLEANIS
LPGLLIEYSTDGGKKWQQYDAKAQPTVSGEVMIRSTSPDGKRSSRAEPVNI
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttaagttaaatgcgttggcggccatcacagctacctttggtttgattggc
tacgcgaacggtagcgccaccaatcaacaagttgttgaccaactcagtaccttgaaagtt
aactataaattattggataaccgtgctgctgataatggcgttgattgcgccaaattgggt
gctgattgggcatcttgtaataaggtcatgataacgctgaccaacaccggggatgagatc
aaaggccaggactgggcgatttattttcacagtattcgtatgattttggctgtggataac
gatcagtttacggtgactcacctgacgggggatctgcacaaaattgaaccaaccgctaag
tttgctggtttccccgccaatcagacaattgaaatcccaattacgggggaatactggcaa
ttatttgccactgactttatgccgcgttggtatgcaacctcgggcgatgccaagccaaaa
gttttggccagtactgatacggaagacattaacgcatacctgacaccgtttaccggtgac
cagtggaagcgtaccaaagacgataataatgtgctgatgacgccagaatcacgtttcgtc
aaaaacgaggcagtgaaaacactctctgcggctaacctgcgtgggcagattatcccaaca
ccactggacgttaaggtttatccgcaagatgccgatctgagcctcggtgtggcgctggaa
ttgagtgcgctacccaaaccggcctctgatgccatacagcaacgttttgaattgctgggc
ctggcgctaagcgcgacgggctatccgattaaaacagtgattcagccaacggccttcaac
ggggatcacgctgtttccggtgcgtatgaactgaaaattggtgagaagggcgcagaggtg
attggttttgatcaggtcggtgtattctatggcctgcaatctatcctttccttggtacct
attgaggggagcaaaacaatagccacccttgatgcgaaagatgcgccacgctttgactac
cgtggtgtctcgctcgatgtggggcgtaacttcaaaaccaaagcggcggtcctacgttta
ttggatcaaatgtctgcttacaaactgaataaattccacttccatctgagtgatgatgaa
ggctggcgcattgagatccctggcctgcctgaattgaccgatgtcggcagccagcgttgc
catgatttgactgaaaccacctgtttgctaccacagctaggctctggccctgagagcaat
aatctggggagcggttatttcactcgcgctgattacatcgatattctgaaatatgccaaa
gcgcgccagattgatgtcattcctgagatagatatcccggctcacgcccgtgctgctgtg
gtatcgatggaagcgcgttataacaatttgatgaaacagggtaaagagaaagaagccaat
gaattccgtctggttgatccgaccgatgactcgaataccacatcagtacagttctatgag
cgtaaaagttacctgaatccctgcctggactcttctaagcattttgtcgacaaagtcatt
ggtgaaatggcgcagatgcacaaagaggccggtatgccgctgaccacctggcatttcggg
ggcgatgaggcgaagaacatccgtctgggggcgggttatcaggataagaatggcaaaatt
gagccaggtaaaggcatcatcgatatgcgcgttgaagataaaccgtgggcgaaatctcag
gtttgtcaggacatggtcaagcaaggcaaagttcaagatattgctcatctttccagctac
ttcgccattgaagtcagcaaactggttaatgcgcacggtatcgaaaaaatgcaggcctgg
caggatggactgagagatgccaaagatgcgagcgcgtttgctaccaagcgtgttggcgtc
aacttctgggataccctctactggggcggagcggactccgtcaacgattgggccaataaa
ggttatgaagtcattgcctcgaatccagattatgtctacttcgatatgccgtatgaagtt
aacccaagtgaacgcggttactactgggcgacgcgctttagcgatgaagccaaggtgttc
agcttcgcacctgacaacatgccacagaacgccgaaacctcggttgatcgcgatggtaat
catttcagtgcgaagagtgataaaccctggccgggtgtacagggtatctccggtcagtct
tggaatgaaacggtacggactgatgagcagatggagtacatggccttccctcgtgtatta
ccgctggctgagcgtgcatggcatcgcgcatcctgggagcaggagtataaagcggggcgt
gaatataaaggtggcgagactcagtgggtcgatactcaggcattaagcacggattggcag
cgtttcgctaacattatggggcaacgtgaactggcaaaactggataaagcgggtgtggct
taccgcttgccagtaccgggggccagagtggtggcggggcagttggaagccaatatttcc
ttgccaggcctccttatcgagtactccactgatggaggcaaaaaatggcagcagtatgat
gctaaagcgcaacctactgtcagcggtgaagtgatgatccgttccaccagcccagacggt
aagcgcagtagccgtgcggagccagttaacatctga

DBGET integrated database retrieval system