KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_1225Help
Entry
YPTS_1225         CDS       T00744                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPTS_1225
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPTS_1225
  Amino acid metabolism
   00310 Lysine degradation
    YPTS_1225
Enzymes [BR:ypb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YPTS_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1371289..1372512
Genome map
AA seq 407 aa AA seqDB search
MSSVDINVPDLPESVADGSVATWHKKPGDSVKRDEVLVEIETDKVILEVPASQDGILDAI
LEDEGATVTSRQVLGRIRPSDSSGKPTEEKSQSTESTPAQRQTASLEEESNETLSPAIRR
LIAEHDLDATAIKGSGVGGRITREDVDSHLASRKSASAVVADAKAVAAAAPVLAGRSEKR
VPMSRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGEAFEKRHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDTLSMADIEKK
IKELAVKGRDGKLKVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
NGQVVILPMMYLALSYDHRLIDGRESVGYLVTVKEMLEDPARLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattaatgttcctgacctccctgagtctgtagccgatggctctgta
gcaacctggcacaaaaaaccaggcgacagcgtcaaacgtgatgaagtgctggttgagatt
gaaacggataaagtgattttggaagtgccagccagtcaggacggtattttggatgccatt
ctggaagatgaaggtgccacagtgacgtcacgtcaggtgctggggcgcattcgtccaagt
gatagttctggtaaaccgactgaagaaaaaagtcagagtacggagtcaactccggctcaa
cgccaaacagccagcttggaagaagaaagtaatgaaaccctcagtccggctattcgccgc
ctgattgctgagcatgatctcgatgcaacggcaatcaaaggcagcggtgttggtggccgt
atcacccgtgaagacgttgatagccatttagcgagccgtaaatcggcctctgcagtggta
gctgacgctaaagcggtagccgctgctgcacctgtattggcggggcgtagtgagaaacgt
gtcccgatgagccgtctgcgtaaacgtgttgctgagcgtctgttagaagcgaaaaacagc
actgcaatgttgaccacgtttaacgaaattaatatgcagcccattatggacctgcgtaag
cagtacggtgaagcttttgagaaacgccacggtgtacgtctgggctttatgtccttctat
atcaaggcagtggttgaagcactgaaacgttatcctgaagtgaatgcttctattgatggc
gaagatgttgtctaccataactatttcgatgtcagtattgcggtttctactccacgtggt
ttggtaacgccagtattacgtgatgtagacacgttgagcatggctgatattgagaagaaa
ataaaagaattggctgtaaaaggtcgtgatggcaagctgaaagttgaagagttgactggc
ggtaactttaccattaccaatggtggcgtgtttggctcactgatgtcgacaccaatcatt
aacccaccacaaagcgcgatccttggcatgcatgccatcaaagatcgcccaatggcggta
aatggtcaggttgtgatcctgcctatgatgtatttggcactttcctacgatcaccgtttg
atcgatggccgcgagtctgttggctatctggtgacggtaaaagagatgctggaagatcct
gctcgcttgctacttgatgtataa

DBGET integrated database retrieval system