KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_1661Help
Entry
YPTS_1661         CDS       T00744                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00040  Pentose and glucuronate interconversions
ypb00052  Galactose metabolism
ypb00500  Starch and sucrose metabolism
ypb00520  Amino sugar and nucleotide sugar metabolism
ypb01100  Metabolic pathways
ypb01130  Biosynthesis of antibiotics
Module
ypb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPTS_1661
   00052 Galactose metabolism
    YPTS_1661
   00500 Starch and sucrose metabolism
    YPTS_1661
   00520 Amino sugar and nucleotide sugar metabolism
    YPTS_1661
Enzymes [BR:ypb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YPTS_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACC88630
JGI: YPTS1661
Position
1869623..1870513
Genome map
AA seq 296 aa AA seqDB search
MKCLKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVDECVAAGVKEIVLVSHSSK
NAIENHFDTSFELEAALESRVKRQLLKEIKNICPADVTIMQVRQGHAKGLGHAVLCAKSM
VGDNPFIVMLPDVLLDDSTADLSKENLASMIKRFEETGHSQIMVEPVPKADVSKYGIADC
GHVALAPGESTLMTAVVEKPSIAEAPSNLAVVGRYVLSKNIWPLLEKTPRGAGDEIQLTD
AIAMLMQQEPVEAFHMTGKSHDCGDKLGYMKAFVTYGVRHHTEGEKFTAWLKQQLD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtttaaaagccgtcattcctgttgctgggcttggcacccgtatgttgcccgcg
actaaagctattccgaaagaaatgctcccggtcgtcgataaacccctgatccagtatatt
gtggatgaatgtgttgccgcaggggtcaaagagatcgtactggtgagccattcatctaag
aatgcgatagagaatcattttgatacttcatttgagctggaagccgcgctggagtcacgg
gttaagcggcagttattaaaagagatcaaaaatatttgcccagcggatgtcaccattatg
caagtgcggcagggccatgctaaaggtctagggcacgcagtgttatgtgctaaatcgatg
gtgggggacaatccttttatcgtcatgctaccggatgtactactggacgattcaacggct
gatttatcaaaagaaaatcttgccagtatgattaaacgcttcgaagaaaccggtcatagc
caaatcatggttgagccagtgcccaaagcggatgtctccaaatacggtattgcggattgt
ggccatgtggcattagcgccaggcgaaagcacgttgatgacagcggtggtagaaaaaccc
tctatagccgaggccccgtctaaccttgctgtagttgggcgctatgtattgtctaaaaat
atctggccgttgcttgagaaaacaccacgcggtgcgggggatgaaattcaactgaccgat
gccattgcgatgttaatgcagcaagagcccgtagaggcatttcatatgacgggtaaatct
catgattgcggcgataaactgggctatatgaaagcttttgtgacttatggtgttcgtcat
catactgaaggtgaaaagtttactgcctggctgaaacagcaactcgattaa

DBGET integrated database retrieval system