KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_1662Help
Entry
YPTS_1662         CDS       T00744                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPTS_1662
   00052 Galactose metabolism
    YPTS_1662
   00500 Starch and sucrose metabolism
    YPTS_1662
   00520 Amino sugar and nucleotide sugar metabolism
    YPTS_1662
Enzymes [BR:ypb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YPTS_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1870597..1871490
Genome map
AA seq 297 aa AA seqDB search
MTKLKAVIPVAGLGMRMLPATKAIPKEMLPIVDKPLIQYVVNECVAAGINEIILITHSSK
NAVENHFDTSYELEAMLEARVKRQLLDEVQSICPPGVTIMHIRQGHPEGLGHAVLCAKPL
VGDSPFVVLLPDVLIDDEQSDLTRDNLAQLVQRFEETGVSQVLVHSVDPETLSNYSVVSC
EKSTLLPGESSRINAMIEKPQSSADLQSNLSAVGRYVLSAHIWPLLEQTKPGAWGRIQLT
DAIDALAAVEAVDAVALTGKSYNCGEKLGYMQAYVAYGLRHPQQGAEFKAWLKDFVA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattgaaagcagtcatccctgtcgctggtttaggcatgagaatgctcccggcg
accaaagctattccgaaagagatgttgccaatcgttgataagccacttatccagtatgtg
gtgaacgaatgtgttgctgcgggcatcaacgaaattattctgataacccattcatccaag
aacgccgtagaaaaccattttgatacttcctatgaattggaagcgatgctggaggcccgt
gttaagcgccagctattggatgaagtgcagtcaatttgcccaccgggtgtgacaataatg
catattcgtcaggggcatccagaggggttgggccacgcggttttatgtgccaaaccgtta
gtgggggattcgccatttgttgtcttgctgccagatgttctaattgatgatgagcaatct
gatttaacccgcgataatctggctcaattagtgcaacgttttgaagagaccggggtcagc
caagttttggttcattcggtagatcctgaaacgctgtctaattattcggtggtttcctgt
gagaaatcgaccttgttgccaggggagagcagccggattaatgccatgatcgagaagcca
caaagttcggcagatttacaatcaaatctgtctgcggtggggcgctatgtactgtcagcg
catatttggccattgttggaacagacgaaacccggcgcttgggggcgtatccaactgacc
gatgctattgatgctttggctgcggtagaggcggttgatgcggttgccttaaccggtaag
tcctataactgcggtgagaaactcggctatatgcaggcttatgtggcttatggtttgcgt
cacccacagcaaggggctgaatttaaggcatggctaaaggatttcgtcgcgtaa

DBGET integrated database retrieval system