KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_2099Help
Entry
YPTS_2099         CDS       T00744                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YPTS_2099
Enzymes [BR:ypb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YPTS_2099
DNA repair and recombination proteins [BR:ypb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     YPTS_2099
    RecFOR pathway proteins
     YPTS_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2322364..2322978
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETNGVGYEVQLPMTCFYELPELGQEAIIFTQFVVREDAQLL
YGFNNKQERALFRELIKVNGVGPKLALAILSGMSAQQFVGAVEREDITTLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNTGDISLPTASPQTSDADIEAEAASALVALGYKPQEASR
LVSKIAKPGADCETLIRDALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataggccgtctcagaggtatcattctggaaaaacagccaccgctggtgctgctggaa
acaaacggtgttggctatgaagtccaattaccaatgacctgcttctatgagttacccgag
ttggggcaggaagccattatcttcacccagtttgtggtacgcgaagatgcgcagttactg
tatggcttcaataataagcaggagcgggcgctgttccgtgaattgatcaaagttaacggc
gtcgggccaaaactggctttagccattctctccgggatgtctgcacagcaatttgttggc
gcagtcgaacgtgaagatattacaacgctggtaaaactgccgggtgtcggtaaaaagacc
gccgagcggttagtggtcgaaatgaaagatcgctttaaaggccttaacggcgatctgttt
aataataccggtgatatctcgttaccaacggcttcgccacaaacctcggatgctgatatc
gaagcggaagccgcttctgcactggtcgcgctgggttataaaccacaagaggccagccgt
ttagtgagtaaaattgccaagccgggtgccgattgtgaaacactgatccgtgatgctctc
cgtgcggcgttataa

DBGET integrated database retrieval system