KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_3146Help
Entry
YPTS_3146         CDS       T00744                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YPTS_3146 (recD)
Enzymes [BR:ypb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     YPTS_3146 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3479640..3481598)
Genome map
AA seq 652 aa AA seqDB search
MMTLLAQAARDRLLRPLDVQFSRMIAGDDDPRLQLAAAILSAEVGAGHVCLPLRYLQPEL
LFGGRQPDLSLALWQAAGSPDKAQWLQALQNAPVVSDGSQPTPLVLQQERLYLQRMWQYE
GDVVQFIASDSVFINRDSDFMTSKGIATSVDESLLRETLDALFGCAGSEVDWQKVAAAVA
ATRRISVISGGPGTGKTTTVAKLLTALIRLSQGQRLRIKLAAPTGKAAARLTESLGKAIR
QFSLTDDERKLFPDQASTLHRLLGVQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMAR
LIAALPAKAKVIFLGDRDQLASVEAGAVLGDICRFAELGYSEQRAQQLTQLTGYLLTNNA
LTSNVLTNKALANKAQPDETYSDSANVRDSLCLLRKSYRFDEKSGIGQLALAVNAGEYRQ
ALSVLNSAYSDVERFPLADEEDYQVLLEACAVGYQHYLERVAALAPAAEVLAAFGRYQLL
CALRSGPFGVSGLNERIEQVLHRKGFIIRPSGPSGRWYVGRPVMIELNDSALGLFNGDIG
IALHDNEGELRVYFQLPDGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFM
PVLTRELVYTAITRARQHLTLYCSDAVLSHAIRTPTLRLSGLVDRLNTLNRQ
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgctattggctcaggctgctcgagaccgcttattgcgcccactggatgtgcag
ttttcacgaatgattgccggcgatgatgacccgcggttacaactggccgcagcgatcctt
agtgcagaagtaggggccggtcatgtttgcctgccattacgctatttacagccagaactg
ctattcggtgggcggcaacccgatttatcactggcgctatggcaggcggcgggctcgcca
gataaagcacagtggctacaggcattacaaaacgccccagtagtcagtgatggctctcaa
ccaacaccattagtgctacagcaggaacgtttatatctgcaacgaatgtggcagtacgaa
ggagatgtcgtccaatttattgccagtgactctgtttttataaacagagatagtgatttt
atgaccagtaaaggtattgccacttctgttgatgaatcgctattacgggagacgctagac
gctttgtttggttgtgctggtagtgaggttgattggcaaaaagtggcggcagcggttgcg
gctacccgtagaatttcagttatttccggcgggccgggcacggggaaaaccaccacagta
gccaaacttttgacagcattgatacggcttagccaggggcaacgtttacgtattaaactt
gcggccccaaccggtaaagccgctgcacgccttactgaatcactgggcaaagcgattcgg
caattctctcttactgatgatgaacgtaaattattccctgatcaggcttcgaccttgcac
cgtttactgggtgttcagcccaatagccagcgcctgcgttaccaccgtggtaatccatta
aatcttgatgtactggtcgttgatgaagcatcaatggttgatttacctatgatggcgcgc
ttaattgcggcattacctgccaaggccaaggtgatattccttggtgaccgtgaccaactg
gcctcggttgaggcgggggcggttctgggggatatctgccgttttgccgaattaggttac
agcgagcaacgggcacagcaattaactcagttaacgggctatttattaactaataatgca
ttaaccagcaatgtactaaccaataaggcattagccaataaagcgcagccagatgaaacc
tattctgattcagcgaatgtacgcgatagcctgtgtttactgcgtaaaagttaccgcttc
gatgaaaagtcagggattgggcagcttgctctggccgttaatgcaggggagtatcggcag
gctttatccgtattaaacagtgcgtattctgatgttgaacgcttcccgctggccgatgag
gaagattatcaggtactgctagaggcttgtgctgtggggtatcagcattacctcgaacgg
gtggctgcgttagcccctgcggcagaggtattggcagcatttggccgctaccaactgctg
tgtgcattacgttccgggccattcggtgtcagtggcttaaacgaacgcattgaacaggtt
ttacatcgtaaaggattcattatccgtccatcagggccttctggccgttggtatgttggg
cggccagtgatgatagaacttaatgatagcgcacttggcttattcaacggggatattggt
attgccttacatgataatgaaggcgagctacgggtatattttcaattgcccgatggcaat
ataaagtcagtacaacctagtcgccttcccagccatgaaaccgcttatgctatgacggtt
cataaatcgcagggttcagagtttgaacacacagcattggtattacctaacacgttcatg
cccgtgttaactcgtgaattggtctataccgccattacccgcgcccgtcagcatctgacg
ctttattgcagcgatgccgtgctaagtcatgccatacgtacaccgactctccggctgagt
gggctagttgatcgcttgaatacattaaatcgccaataa

DBGET integrated database retrieval system