KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_3717Help
Entry
YPTS_3717         CDS       T00744                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ypb00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ypb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4137740..4138675
Genome map
AA seq 311 aa AA seqDB search
MTNPLYHKHIISINDLSRDELELVLRTAASLKKTPQPELLKHKVIASCFFEASTRTRLSF
ETSIHRLGASVVGFSDSSNTSLGKKGETLADTMSVISTYVDAIVMRHPQEGASRLAAQFS
GNVPIVNAGDGANQHPTQTLLDLFTIQETQGRLDNINIAMVGDLKYGRTVHSLTQALAKF
NGNHFFFIAPDALAMPAYILQMLEEKEIEYSLHESLEEVVPELDILYMTRVQKERLDPSE
YANVKAQFILRSSDLTGARDNLKVLHPLPRIDEITTDVDKTPYAYYFQQAGNGIFARQAL
LALVLNAELAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatccgttgtatcacaaacatatcatctcaattaacgatttaagtcgcgatgaa
ctagaactggtcttgcgtactgccgccagcctgaaaaagactccgcagccagagttgtta
aaacataaagtgatcgccagttgcttttttgaagcgtcgacccgcacccgcttgtcattt
gaaacatccattcaccgcctgggtgcctcggtcgtgggcttttctgatagcagcaatacc
tcattgggtaagaaaggcgagacactggcagacaccatgtcagtcattagcacttatgtt
gacgccattgtgatgcgccatccacaagaaggggcttcacgtctggccgcgcaattctcg
gggaatgtgcctatcgtgaatgccggtgacggcgcaaaccagcacccaacacaaaccctg
ctcgatttattcactattcaggaaacgcagggccggctggataacatcaatatcgccatg
gtaggtgacctgaaatatggccgtaccgtgcattcattgacgcaagcgctggcaaaattc
aatggcaaccacttcttctttatcgcccctgatgcgctggcaatgcccgcttatattttg
caaatgttggaagaaaaagagattgagtacagcctgcatgaaagcctcgaagaggtggtg
ccggagttagatattctctatatgactcgcgtacagaaagagcgccttgacccatcggaa
tatgccaatgtcaaagcacagtttattttgcgctcttctgatttaacgggcgcacgggat
aatcttaaagtgttgcacccgctgccacgtattgacgaaatcacaaccgatgtcgataaa
accccctacgcctactatttccaacaagcgggtaacggtatttttgcacgtcaggcgcta
ctggcactggtattaaacgcagaattagctctttaa

DBGET integrated database retrieval system