KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_3798Help
Entry
YPTS_3798         CDS       T00744                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPTS_3798
Enzymes [BR:ypb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YPTS_3798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4232198..4233127
Genome map
AA seq 309 aa AA seqDB search
MSVFILGSYAKALVMTTDRIPLAGETLIGYDFRQTWGGKGSDMAVQAVRLGAEVAYAGVV
GDDTFGHEFVGLMQEEGVNIDALTISGELPTGAGLIVKDKEARNVIVVDMGANKLFTPAL
VDSALSQLKQSNVVLAQLEIPLETALYGLQRAKEFGKITILNPAPARDLRGLDLSAIDYL
TPNETEARVALGLPPDDPRSNREIANLLLETGCQYVVMTLGESGSAVFGRNDTQEIPPCI
IDVVDSNGAGDSFNAALAVALDEGLPISEAVLFANATAALCCMDWETVPSYRYREDVDAF
MRSITVKEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatttattctcggcagctatgcgaaagcgctggtgatgaccaccgaccgtatt
cctctggctggggaaacgctgattggctatgactttcgccagacgtggggcggtaaaggc
tcggatatggcggttcaggcagtgcgtctgggggcagaggtcgcctatgcgggtgtcgtc
ggtgatgacacctttggccatgaatttgtcggcttgatgcaggaagaaggcgtcaatatc
gacgcattaaccatcagcggagaattaccaacgggggcgggacttatcgttaaagataaa
gaagcccgtaacgtgattgtcgtggatatgggggccaataaactgtttaccccagcgttg
gtggacagcgccttatcccagctcaaacaaagcaatgtggtgctcgcacagcttgaaatt
ccgctggaaacggcactttacggactccaacgggcaaaagaattcggcaaaataaccatc
ctgaacccggctccggcaagggatctgcgcggtctcgatctcagcgcgattgattatttg
acccctaatgaaacggaagcccgcgtggctctgggtctgcctccggatgacccacgcagt
aaccgagagattgccaacctcttactggaaaccggttgccaatatgtcgtgatgacgctg
ggtgaatcaggttctgcggtgtttggtcgcaacgacacacaagaaatccccccctgcatc
attgatgtcgtcgacagtaacggtgcaggtgacagctttaacgcggcactggccgtcgcg
ctggatgaagggctgccgattagcgaagctgtgctgtttgctaacgccacggcggcgttg
tgctgtatggattgggaaacggttccgtcctatcgctaccgcgaagatgtcgatgctttt
atgcgatctataaccgtgaaagaggaataa

DBGET integrated database retrieval system