KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_3842Help
Entry
YPTS_3842         CDS       T00744                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00630  Glyoxylate and dicarboxylate metabolism
ypb01100  Metabolic pathways
ypb01110  Biosynthesis of secondary metabolites
ypb01120  Microbial metabolism in diverse environments
ypb01200  Carbon metabolism
Module
ypb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YPTS_3842
Enzymes [BR:ypb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YPTS_3842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ACC90795
JGI: YPTS3842
Position
complement(4293496..4294803)
Genome map
AA seq 435 aa AA seqDB search
MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECTFAQNGAKKLWELLHG
GSRKGYINCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFASHQQEVGTGYFDKVTNIIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctctcgtactcaacaaattcagcagttggaacaggaatggacatcgccgcgc
tggaaaaatatcactcggccttatagcgccgaagatgttatcaagctgcgtggttcggtc
aatccagaatgtacgttcgcacaaaatggtgccaaaaaactgtgggaattgctgcacggc
gggtcgcgtaaagggtatatcaactgtctgggggcattaaccggtggtcaggcgctacaa
caggcgaaagccggtgttgaagccatttatctgtcgggatggcaggtggcggctgatgct
aatacggcatctagcatgtatccagatcagtcactgtatccggtcgactctgtgcctgcg
gtggtgaaacgtatcaacaatagcttccgccgcgctgatcaaattcagtggtcgaataat
attgagccaggtagtaaaggctataccgactatttcctaccgatcgtcgcggatgcggaa
gcgggttttggcggtgtgctgaacgcgtttgaattaatgaaagcgatgattgaagcgggg
gcggcaggggttcattttgaagaccaattggccgcagtgaaaaagtgtgggcatatgggc
ggtaaggtactggtgccgacacaagaggccattcaaaagctggttgctgcccgtttagcc
gcagatgtcttgggtgtaccaacgctgttgattgccaggactgatgcggatgcggctgat
ttattgacctcagattgcgatccctatgaccgggagtttattaccggcgaccgtactgcg
gaaggttttttccgcacccgtgccggtattgaacaagcgatcagccgtggtctggcgtac
gccccttatgctgatttggtgtggtgtgaaacctcgacacctgatctggctctggccaaa
cgttttgccgatgctgttcatgctcaattccccggaaaattactggcttataactgttca
ccctcctttaactggaagaagaatctgaccgaccagcaaattgccagcttccaagatgaa
ctctccgccatgggctacaaataccagtttattacgctggcgggtattcatagcatgtgg
ttcaacatgttcgatctggcccatgcgtatgcgcagggtgaaggcatgaaacactacgtt
gagaaagtccagcaacctgagtttgcctctgtggaccgcggctacacctttgcttcccat
cagcaagaagtggggactggctacttcgataaagtcaccaatattattcaggggggcgca
tcatctgtaacggcactgaccggttcgacggaagagcagcagttttag

DBGET integrated database retrieval system