KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_4053Help
Entry
YPTS_4053         CDS       T00744                                 

Definition
(GenBank) glycoside hydrolase family 8
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Brite
Enzymes [BR:ypb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     YPTS_4053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(4528959..4530074)
Genome map
AA seq 371 aa AA seqDB search
MVVMFKHLASMFLLLASFSLAAASNWPAWQQFKQDYISEGGRIIDPGSPSKITTSEGQSY
GLFFALVADDQPMFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADI
LIAYNLLEAGRLWGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLN
PSYLPPQLLARFSSIDGPWEAMVEVNQRMWLETAPNGFSPDWVVWQKGKGWQPDTIKPDV
GSNDAILVYLWAGMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGSVG
FSAALLPFLASSPEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQ
GELQPSWHRQR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcatgtttaaacacttagccagcatgttcctgttgctggccagttttagtctc
gcagccgccagtaactggcccgcgtggcaacagttcaaacaagattacatcagtgaaggg
gggcggatcattgaccccggtagcccctcgaaaataaccacctcggaaggccagagttat
gggcttttttttgcattggttgcggatgatcagccgatgtttgagcgtttattggcttgg
acagaaaacaatctggcagccggtgatctcacttcccgccttcccgcttggttatggggg
caaaactcacaaaataactgggatattctggaccctaattcggcctccgatgcggatatc
ttgattgcctacaacttgctggaggctggcaggttatggggtaaccgccgttacctgatt
atgggtaccttattactgcaacgtattgcgcaagaagaagtcatggatattcccggcctt
ggccagatgctattaccgggaaaaattggttttaacgatgaggatacctggcgtctcaac
ccaagttatttaccgccacaactactggcacgattttcctccatagacgggccttgggaa
gcgatggtagaagtgaatcagcgtatgtggttggaaaccgcaccaaacggtttttcgccg
gactgggtggtctggcagaagggtaaaggctggcagcccgataccataaaaccggatgtc
ggcagtaacgatgccattctggtttatctgtgggcggggatgctggcaatggacagccca
caaaaagctgaattgattgcgcgttttcagccaatggcggtaatcactcagcagcaaggc
ctgccaccgtttacgaccaacagcgacaatggtaaaactaacggggatgggtcagtgggg
ttttctgcggcattattgccctttttagccagcagcccagaaccgtttaatcagcaaaca
ctgaatctccaacagcgacgggtacaaaattcaccgcctggcgctgatgattattacagt
gctattctgaccctgtttggtcaggggtggttacagcatcgttatcattttacccatcag
ggagagctacagccctcatggcaccgtcaacgttaa

DBGET integrated database retrieval system