KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_4053Help
Entry
YPTS_4053         CDS       T00744                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ypb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4528959..4530074)
Genome map
AA seq 371 aa AA seqDB search
MVVMFKHLASMFLLLASFSLAAASNWPAWQQFKQDYISEGGRIIDPGSPSKITTSEGQSY
GLFFALVADDQPMFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADI
LIAYNLLEAGRLWGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLN
PSYLPPQLLARFSSIDGPWEAMVEVNQRMWLETAPNGFSPDWVVWQKGKGWQPDTIKPDV
GSNDAILVYLWAGMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGSVG
FSAALLPFLASSPEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQ
GELQPSWHRQR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcatgtttaaacacttagccagcatgttcctgttgctggccagttttagtctc
gcagccgccagtaactggcccgcgtggcaacagttcaaacaagattacatcagtgaaggg
gggcggatcattgaccccggtagcccctcgaaaataaccacctcggaaggccagagttat
gggcttttttttgcattggttgcggatgatcagccgatgtttgagcgtttattggcttgg
acagaaaacaatctggcagccggtgatctcacttcccgccttcccgcttggttatggggg
caaaactcacaaaataactgggatattctggaccctaattcggcctccgatgcggatatc
ttgattgcctacaacttgctggaggctggcaggttatggggtaaccgccgttacctgatt
atgggtaccttattactgcaacgtattgcgcaagaagaagtcatggatattcccggcctt
ggccagatgctattaccgggaaaaattggttttaacgatgaggatacctggcgtctcaac
ccaagttatttaccgccacaactactggcacgattttcctccatagacgggccttgggaa
gcgatggtagaagtgaatcagcgtatgtggttggaaaccgcaccaaacggtttttcgccg
gactgggtggtctggcagaagggtaaaggctggcagcccgataccataaaaccggatgtc
ggcagtaacgatgccattctggtttatctgtgggcggggatgctggcaatggacagccca
caaaaagctgaattgattgcgcgttttcagccaatggcggtaatcactcagcagcaaggc
ctgccaccgtttacgaccaacagcgacaatggtaaaactaacggggatgggtcagtgggg
ttttctgcggcattattgccctttttagccagcagcccagaaccgtttaatcagcaaaca
ctgaatctccaacagcgacgggtacaaaattcaccgcctggcgctgatgattattacagt
gctattctgaccctgtttggtcaggggtggttacagcatcgttatcattttacccatcag
ggagagctacagccctcatggcaccgtcaacgttaa

DBGET integrated database retrieval system