KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_4108Help
Entry
YPTS_4108         CDS       T00744                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPTS_4108
   00051 Fructose and mannose metabolism
    YPTS_4108
Enzymes [BR:ypb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     YPTS_4108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4589274..4590593
Genome map
AA seq 439 aa AA seqDB search
MQSYFNELEQVRYEGSQSTNPLAFHHYNPDEMILGKRMADHLRFAACYWHTFCWGGADMF
GANAFDRPWQQPGDALALAKRKAEVAFEFFHKLNVPYYCFHDVDVSPEGASLQEYLNNFA
VMTDVLAEKQAASGVKLLWGTANCFTHPRYGAGAATNPDPEVFSWAATQVFTAMNATRQL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRG
DPQLGWDTDQFPNSVEENTLVMFEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKFAAKMIEDGQLDQIVAKRYAGWNSELGQQILQGKMSLEELSRYASQHNLNPQ
HQSGHQELLENKVNRYLFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcttattttaatgaattagaacaagtgcgctacgaaggtagccagagcacgaat
cctctggcgtttcatcactacaacccggatgaaatgatccttggtaagcgaatggctgac
catctgcggtttgccgcctgttactggcataccttctgctggggtggggccgatatgttc
ggtgccaatgcttttgatcgcccatggcaacaacctggggatgcactggctctggctaaa
cgcaaagccgaggttgcatttgaattcttccataaactgaatgtaccgtattactgcttc
catgatgtggatgtctcgccagaaggcgcgtcactacaggaatatctgaataacttcgcc
gtaatgaccgatgtactggctgaaaaacaagcagccagtggtgtgaaattattatggggc
acggctaactgctttacccatcctcgttatggtgctggtgccgcgaccaatcctgatcca
gaagtatttagctgggcagccacccaggtctttacggccatgaatgccacccgccaactc
ggcggtgaaaactatgtgttatggggcggacgtgaaggctacgaaacactgttgaatacc
gatttgcgacaagagcgtgaacaaattggccgctttatgcaaatggtcgtcgaacataaa
cacaaaacgggtttccaggggacactccttattgagccaaaaccgcaggagcccactaaa
catcaatacgattatgacgtcgcgacagtttacggcttccttaagcagttcggcttagaa
aaagagattaaagtcaatattgaagccaaccatgccacgctggcggggcactctttccat
cacgaaattgccagtgccatcgccttaggtatttttggctcagtggatgctaaccggggc
gatccgcaactgggctgggataccgatcaattcccaaacagtgtagaagaaaatacactg
gtgatgttcgagatcctcaaagcaggcggttttaccaccgggggcctgaattttgatgcc
aaagtgcgccgccaaagtaccgataaatatgatctgttctacggtcatattggcgcaatg
gacaccatggcactggcgctaaaatttgccgccaaaatgattgaagatgggcaattagat
cagatcgttgccaaacgttatgccggttggaatagcgagctgggccaacagatcctgcaa
ggtaaaatgtcgctggaagagctctcccgctatgccagtcaacataatctgaacccgcag
caccaaagcggtcatcaagagttgttggagaataaggttaaccgctatttatttggttga

DBGET integrated database retrieval system