KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_4163Help
Entry
YPTS_4163         CDS       T00744                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPTS_4163
Enzymes [BR:ypb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YPTS_4163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4652302..4653228)
Genome map
AA seq 308 aa AA seqDB search
METGKLVVLGSINADHILNIEQFPRPGETVIGQQYNVAFGGKGANQAVAAGRSGADIAFI
ACVGDDDIGERVRQQLTADKIDTQPIEAIKGATTGVALIFVNSDGENVIGINAGANSAVT
PEYLRRYQQQVIDADALLMQLESPLDTVIAAAKLAKQHQTQVILNPAPARKLPDELLTLV
DMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIATVIITLGSRGVWLSEQGKGKLVA
GFKVNAVDTIAAGDTFNGALLTALLEGQSMDAAVRFAHAAAAIAVTRPGAQPSIPWRAEI
DSFLQERV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggtaagctggtggtgttgggcagtatcaatgccgaccatattctgaatatt
gagcagtttccacgtccgggtgaaacggtgatcgggcagcagtataacgttgctttcgga
ggtaaaggggctaatcaagcggttgctgctggccgtagcggtgcggatatcgcatttatt
gcctgtgtgggtgacgatgatattggtgaacgggtgcgtcagcaactcactgccgataag
attgatactcagcctatcgaggctattaagggggcaactaccggtgtggcattgatcttc
gtgaatagcgatggcgaaaatgtgattggtattaatgcgggggctaactcagcggtgaca
ccagagtatcttcgccgctaccaacaacaagtgatcgatgctgatgcactcttaatgcaa
ctggagtcgccgctcgacactgttattgcggccgctaaactggcgaagcagcatcaaact
caggttatcctcaatccggcacccgcccgtaaattacccgatgaattattaactctggtc
gatatgattacgcctaatgaaacggaagccgagcgtttgaccggcattcatattgagcag
gatgatgatgccgcgaaagcagcgcaaattttgcatgataaaggcattgctaccgtgatc
atcaccttaggtagtcgtggcgtatggctcagtgaacaaggtaaaggtaaattagtggcg
gggttcaaggtaaatgccgtagataccattgctgccggtgatacgtttaacggtgcatta
ttgacagcgttattagaaggccagtctatggatgccgcagtgcgttttgctcatgccgcg
gcggctattgcggtcactcggcctggagcacagccgtccattccatggcgtgccgaaatt
gatagcttcttacaagaacgagtgtaa

DBGET integrated database retrieval system