KEGG   Yersinia pestis D106004: YPD4_0079Help
Entry
YPD4_0079         CDS       T01832                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00010  Glycolysis / Gluconeogenesis
ypd00051  Fructose and mannose metabolism
ypd00562  Inositol phosphate metabolism
ypd01100  Metabolic pathways
ypd01110  Biosynthesis of secondary metabolites
ypd01120  Microbial metabolism in diverse environments
ypd01130  Biosynthesis of antibiotics
ypd01200  Carbon metabolism
ypd01230  Biosynthesis of amino acids
Module
ypd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypd_M00002  Glycolysis, core module involving three-carbon compounds
ypd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPD4_0079 (tpiA)
   00051 Fructose and mannose metabolism
    YPD4_0079 (tpiA)
   00562 Inositol phosphate metabolism
    YPD4_0079 (tpiA)
Enzymes [BR:ypd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YPD4_0079 (tpiA)
Exosome [BR:ypd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YPD4_0079 (tpiA)
  Exosomal proteins of bladder cancer cells
   YPD4_0079 (tpiA)
  Exosomal proteins of melanoma cells
   YPD4_0079 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACY56988
Position
complement(96169..96936)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIG
LIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggtagtactcatatggttaac
gagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggcgttgccatt
gccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagccgtattgct
ctgggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaaacatctgct
gaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgagcgccgtact
tatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaagagatcggc
ttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggccaaactgaa
gcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaagcgttcgaa
ggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatcagcaactcca
gcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaagacgcagca
gttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaacgcagcagaa
ttgttcactcagccagatattgatggcgcactggttggcggtgcatcactgaaagcagac
gctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system