KEGG   Yersinia pestis D106004: YPD4_0084Help
Entry
YPD4_0084         CDS       T01832                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ypd  Yersinia pestis D106004
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ypd00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(100771..102294)
Genome map
AA seq 507 aa AA seqDB search
MTTENTTQKKYIVALDQGTTSSRAVVLDHNANIVSVSQREFTQIYPKAGWVEHDPMEIWA
TQSSTLIEVLAKAGINSDEIAGIGITNQRETTIVWDKVTGKPVYNAIVWQCRRTADICEK
LKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARERAERGELLFGTVDTWLVWNMT
QGRVHVTDYTNASRTMMFNIRTKEWDDRMLKALNIPRAMLPEVRPSSEIYGKTNIGGKGG
TRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNTGEEAVQSTHGLLTTIACGP
RGEVNYALEGAVFIGGASIQWLRDELKLIGDATDSEYFATKVKNSNGVYVVPAFTGLGAP
YWDPYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGARLKSLRVDGGAVA
NNFLMQFQADILGTRVERPAIRESTALGAAFLAGLATGFWDDLDEVKSKASIEREFRPGI
ETTERDIRYKGWKKAVARARDWEEHDE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaaatactactcaaaaaaaatacattgtcgcacttgatcaggggacaacc
agctccagggcggtagtactggatcacaatgcaaatatcgtgagtgtttctcagcgtgaa
ttcactcagatttacccaaaggctggctgggttgagcatgacccaatggagatctgggcg
acccaaagctctacactgattgaagtcctggccaaagccggtatcaactctgatgaaatc
gcgggtatcggtattaccaatcagcgcgaaaccacgattgtttgggataaagtgaccggt
aagccggtgtataacgccattgtctggcaatgccgccgtactgcggatatttgcgaaaaa
ctgaaaaaagaagggctggaagagtatatccgccacaacaccggtttggtggtagatccc
tacttctctggcacaaaagtgaaatggatcctcgataacgtcgagggcgctcgcgagcgc
gctgaacgcggtgagttactgtttggtaccgtagacacctggctggtgtggaatatgacg
caaggccgtgtgcacgtcaccgactataccaacgcatcacggaccatgatgtttaacatc
cgtaccaaggagtgggacgaccgtatgctgaaagcgctgaatattccacgcgccatgcta
ccggaagttcgcccatcctccgaaatctacggcaaaaccaatatcggtggcaaaggtggc
actcgtattccaatcgccgggattgccggtgaccagcaagccgctctgtttggtcagctt
tgtgtacagccgggcatggcaaaaaatacctacggtacgggttgcttcctgctgatgaac
accggtgaagaagcggttcaatctactcatggcctgttgaccaccattgcctgtggccca
cgcggtgaagtgaattatgcactggaaggggctgtatttattggtggtgcctccattcaa
tggctacgtgatgaattgaagttgataggcgatgccaccgattctgagtatttcgcgacc
aaagtgaaaaacagtaatggtgtgtatgtggtaccggccttcaccggtctgggcgctcct
tactgggacccgtatgcccgtggtgcgattttcggcctgacccgtggtgttaacagcaac
cacattatccgtgcaacgctcgaatccatagcttatcagacccgcgatgtcttggatgcc
atgcaagctgactccggcgcacggctgaaatcactgcgtgttgatggcggtgcagtagct
aataacttcctgatgcagttccaggccgatattctgggtacccgtgttgagcgccctgct
attcgtgaaagtacagcattgggtgctgcattcctggcaggtctggcgacgggcttctgg
gatgacctcgatgaggtgaagagtaaagcaagcattgaacgcgaattccgtccagggatt
gaaaccacagagcgtgatatccgttacaagggctggaaaaaagcagtggcccgcgcccgg
gattgggaagagcacgacgagtaa

DBGET integrated database retrieval system