KEGG   Yersinia pestis D106004: YPD4_0220Help
Entry
YPD4_0220         CDS       T01832                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00010  Glycolysis / Gluconeogenesis
ypd00620  Pyruvate metabolism
ypd00640  Propanoate metabolism
ypd00680  Methane metabolism
ypd01100  Metabolic pathways
ypd01110  Biosynthesis of secondary metabolites
ypd01120  Microbial metabolism in diverse environments
ypd01130  Biosynthesis of antibiotics
ypd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPD4_0220 (acs)
   00620 Pyruvate metabolism
    YPD4_0220 (acs)
   00640 Propanoate metabolism
    YPD4_0220 (acs)
  Energy metabolism
   00680 Methane metabolism
    YPD4_0220 (acs)
Enzymes [BR:ypd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YPD4_0220 (acs)
Lipid biosynthesis proteins [BR:ypd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YPD4_0220 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACY57129
Position
complement(247735..249693)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGKIIDWIKPYKTVKNTSF
DPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPNQSKTVTYKQLHHDVCQF
ANVLKSLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHS
KLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWHDL
IKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTA
IRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLATPDILHWTD
SLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacataaacatcctattccagctgcaattgcagagcatgctctaattacc
ccagaaaaataccaacattattaccaacaatccgtgcagaaccctgatgaattctggggc
gaacaaggcaaaatcattgattggattaaaccctataaaacggtaaaaaatacctccttt
gaccccggtcatgtgagtatccgctggtttgaggacggtacattgaacctcgcggcgaat
tgccttgatcgccatttggcagagcgtggtgatcaaacagccatcatttgggaaggtgat
gaccctaatcaatcaaaaaccgtcacttataagcaactgcaccatgatgtgtgccagttt
gctaatgtcctaaaaagtttaggcgtcaaaaaaggcgatgtggttgccatctatatgcca
atggtgcctgaagctgccgtggcgatgttggcttgcgcgcgcatcggcgctgttcattcc
gttatctttggtggattttctccagatgccgttgccgggcgtatcatcgattctcactct
aaactggtgattactgccgatgaaggtatccgtgcaggccgtgctattccactgaaaaaa
aatgtcgatgaagcactgaaaaaccccgctatcaccagtattaaaaatgttgtggtcttc
caacgtactggtaacgccagctattgggaagatgggcgcgatgtatggtggcatgacctg
ataaaagaggcatccgctgactgcccgccagaagagatgaatgcagaagacccgctgttc
atcctttatacctctggctctaccggtaaacctaaaggggttgtacatacgacgggcggt
tatctggtttatgctgcactgacattcaaatatgtctttgattatcaccctggcgatatc
tactggtgtactgcagacgttggctgggtaaccggacacagctatctgttatatggacca
ctggcttgtggggccatcactctaatgtttgaaggcgtgcctaactaccctggcgtcaat
cgcttaagccaagttgttgataaacataaagtcaatattctatacaccgcgcctacagcg
attcgggccttaatggccgaaggtgacaaagccatcgaaggaaccaaacgcgactcactg
cgtattatgggatcggtcggcgagccgattaatccagaagcctgggaatggtattacaac
aagatcggtaacagtaaatgcccgattgtcgatacttggtggcagactgaaaccggtggt
ttcatgataacccctctgccgggtgccaccgagttgaaagccggttccgcaacgcgtcca
ttctttggggtacaacctgcgttggtagataacctgggcaatcctcaggaaggggtggca
gaaggtaatctggtcataaccgactcatggccggggcaagccagaacattatttggcgat
catgaacgtttcgaacaaacctacttctcaacctttaaaggcatgtatttcagtggcgac
ggcgcacgtcgtgacgaagacggttactactggataaccggtcgagttgatgacgtacta
aacgtttcaggccatcgcttaggaacggctgaaattgaatctgcattggttgcacacccg
aaaattgccgaagcggctgttgtcggtgttccacataatattaaaggacaggctatttat
gcctatatcacgctaaatcacggtgaagaaccaacgccagagttatataccgaagtacgc
aactgggtacgtaaagagattggcccactcgcaacacccgatattttgcattggacggac
tcattacccaaaacccgttcaggcaagatcatgcgccgtattttacgcaaaattgcgaca
ggagataccagcaacttgggcgatacctcaacacttgccgatccaagcgtggtagaaaaa
ttactagaagaaaaacaatcaatgcagacaccgtcgtaa

DBGET integrated database retrieval system