KEGG   Yersinia pestis D106004: YPD4_0377Help
Entry
YPD4_0377         CDS       T01832                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypd  Yersinia pestis D106004
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPD4_0377
Enzymes [BR:ypd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YPD4_0377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
454377..455156
Genome map
AA seq 259 aa AA seqDB search
MITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLSADLAQAIVGVANGAGCKTTALLTD
MNQVLASSAGNGVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAHDEADARAKLQ
AVLDNGKAAEVFGRMVAAQKGPADFVERYDSYLPVATLSKPVFAEQTGIITAMDTRALGM
AVVALGGGRRRATDPIDYSVGLTEMARLGTRVDGQQPLAVIHANNEDDWQQAAEVVRAAI
TLGNNTPEETPVIYRRITE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgattacggcctctattctggccaaaaaattggcggaagggctggatgcattggtcatg
gacgtgaaggtcggctccggtgcctttatgccaacctactcgttgtcggctgatttggcg
caggcgattgttggtgtggcaaacggtgcgggttgcaaaaccacggcgctactgacggac
atgaaccaagtcctggcgtccagcgccggtaatggggtcgaagtccgcgaagctgtgcgt
ttcctgacgggcgaatatcgcaacccacgtttgctggaagtgactatggcgctgtgtgtt
gaaatgttgctgtcaggcggtttagcgcacgatgaagccgatgcccgtgccaagctgcaa
gccgttttggataatggcaaagcggcggaagtctttggccgtatggtggccgcgcaaaaa
ggcccggcagactttgttgaacgctatgacagctacctgcccgttgctaccctaagcaaa
ccggtatttgctgaacagacgggaatcattactgcaatggatacccgcgccttgggtatg
gcggtggtcgccctcggcgggggacgccgtcgggcaacggatcccattgattatagtgta
gggctgacggagatggcccgtttgggtacccgtgttgatgggcagcagccgcttgcggtg
atccatgccaataacgaagatgactggcagcaggcggcagaggttgtgcgtgcggccatc
accttagggaataacacgccagaagaaacgccagtgatttatcgccgtatcactgaataa

DBGET integrated database retrieval system