KEGG   Yersinia pestis D106004: YPD4_0424Help
Entry
YPD4_0424         CDS       T01832                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ypd  Yersinia pestis D106004
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypd00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ypd00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
514744..515226
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN
IVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEV
GGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgatcgctgcattggcagcagatcgcgttattggcatggaaaacgct
atgccatggcatttaccggctgatttagcgtggttcaaacgtaacacgttaaataaaccg
gtaattatgggtcgtaagaccttcgaatctatcggtcgcccccttccgggaagactgaat
attgtcatcagtagccagcctggtactgatgaacgtgtgacgtgggcggcctcgattgaa
gaagcattggcgtttgctggcaatgcggaagaagtgatggtcatgggcggtggccgtgtc
tataagcaattcttagaccgcgcaaatcgcatgtatctcacgcatattgatgcggaggtc
ggtggcgatactcacttccctgattatgagccagatgaatgggaaagcgtattcagtgag
tttcatgatgccgatgaagctaactcacacagttattgcttcgaaattctagagcgccgc
taa

DBGET integrated database retrieval system