KEGG   Yersinia pestis D106004: YPD4_0887Help
Entry
YPD4_0887         CDS       T01832                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ypd  Yersinia pestis D106004
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YPD4_0887 (recD)
Enzymes [BR:ypd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     YPD4_0887 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1150961..1152919
Genome map
AA seq 652 aa AA seqDB search
MMTLLAQAARDRLLRPLDVQFSRMIAGDDDPRLQLAAAILSAEVGAGHVCLPLRYLQPEL
LFGGRQPDLSLALWQAAGSPDKAQWLQALQNAPVVSDGSQPTPLVLQQERLYLQRMWQYE
GDVVQFIASDSVFINRDSDFMTSKGIATSVDESLLRETLDALFGCAGSEVDWQKVAAAVA
ATRRISVISGGPGTGKTTTVAKLLTALIRLSQGQRLRIKLAAPTGKAAARLTESLGKAIR
QFFLTDDERKLFPDQASTLHRLLGVQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMAR
LIAALPAKAKVIFLGDRDQLASVEAGAVLGDICRFAELGYSEQRAQQLTQLTGYLLTNNA
LTSNVLTNKALANKAQPDETYSDSANVRDSLCLLRKSYRFDEKSGIGQLALAVNAGEYRQ
ALSVLNSAYSDVERFPLADEEDYQVLLEACAVGYQHYLERVAALAPAAEVLAAFGRYQLL
CALRSGPFGVSGLNERIEQVLHRKGFIIRPSGPSGRWYVGRPVMIELNDSALGLFNGDIG
IALHDNEGELRVYFQLPDGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFM
PVLTRELVYTAITRARQHLTLYCSDAVLSHAIRTPTLRLSGLVDRLNTLNRQ
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgctattggctcaggctgctcgagaccgcttattgcgcccactggatgtgcag
ttttcacgaatgattgccggcgatgatgacccgcgattacaactggccgcagcgatcctt
agtgcagaagtaggggccggtcatgtttgcctgccattacgctatttacagccagaactg
ctattcggtgggcggcaacccgatttatcactggcgctatggcaggcggcgggctcgcca
gataaagcacagtggctacaggcattacaaaacgccccagtagtcagtgatggctctcaa
ccaacaccattagtgctacagcaggaacgtttatatctgcaacgaatgtggcagtacgaa
ggagatgtcgtccaatttattgccagtgactctgtttttataaacagagatagtgatttt
atgaccagtaaaggtattgccacttctgttgatgaatcgctattacgggagacgctagac
gctttgtttggttgtgctggtagtgaggttgattggcaaaaagtggcggcagcggttgcg
gctacccgtagaatttcagttatttccggcgggccgggcacggggaaaaccaccacagta
gccaaacttttgacagcattgatacggcttagccaggggcaacgtttacgtattaaactt
gcggccccaaccggtaaagccgctgcacgccttactgaatcactgggcaaagcgattcgg
caattctttcttactgatgatgaacgtaaattattccctgatcaggcttcgaccttgcac
cgtttactgggtgttcagcccaatagccagcgcctgcgttaccaccgtggtaatccatta
aatcttgatgtactggtcgttgatgaagcatcaatggttgatttacctatgatggcgcgc
ttaattgcggcattacctgccaaggccaaggtgatattccttggtgaccgtgaccaactg
gcctcggttgaggcgggggcggttctgggggatatctgccgttttgccgaattaggttac
agcgagcaacgggcacagcaattaactcagttaacgggctatttattaactaataatgca
ttaaccagcaatgtactaaccaataaggcattagccaataaagcgcagccagatgaaacc
tattctgattcagcgaatgtacgcgatagcctgtgtttactgcgtaaaagttaccgcttc
gatgaaaagtcagggattgggcagcttgctctggccgttaatgcaggggagtatcggcag
gctttatccgtattaaacagtgcgtattctgatgttgaacgcttcccgctggccgatgag
gaagattatcaggtactgctagaggcttgtgctgtggggtatcagcattacctcgaacgg
gtggctgcgttagcccctgcggcagaggtattggcagcatttggccgctaccaactgctg
tgtgcattacgttccgggccattcggtgtcagtggcttaaacgaacgcattgaacaggtt
ttacatcgtaaaggattcattatccgtccatcagggccttctggccgttggtatgttggg
cggccagtgatgatagaacttaatgatagcgcacttggcttattcaacggggatattggt
attgccttacatgataatgaaggcgagctacgggtatattttcaattgcccgatggcaat
ataaagtcagtacaacctagtcgccttcccagccatgaaaccgcttatgctatgacggtt
cataaatcgcagggttcagagtttgaacacacagcattggtattacctaacacgttcatg
cccgtgttaactcgtgaattggtctataccgccattacccgcgcccgtcagcatctgacg
ctttattgcagcgatgccgtgctaagtcatgccatacgtacaccgactctccggctgagt
gggctagttgatcgcttgaatacattaaatcgccaataa

DBGET integrated database retrieval system