KEGG   Yersinia pestis D106004: YPD4_0965Help
Entry
YPD4_0965         CDS       T01832                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00020  Citrate cycle (TCA cycle)
ypd00190  Oxidative phosphorylation
ypd00650  Butanoate metabolism
ypd01100  Metabolic pathways
ypd01110  Biosynthesis of secondary metabolites
ypd01120  Microbial metabolism in diverse environments
ypd01130  Biosynthesis of antibiotics
ypd01200  Carbon metabolism
Module
ypd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPD4_0965 (sdhD)
   00650 Butanoate metabolism
    YPD4_0965 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    YPD4_0965 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACY57874
Position
1245061..1245408
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system