KEGG   Yersinia pestis D106004: YPD4_1112Help
Entry
YPD4_1112         CDS       T01832                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ypd  Yersinia pestis D106004
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPD4_1112 (bglA)
Enzymes [BR:ypd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     YPD4_1112 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1425004..1426440
Genome map
AA seq 478 aa AA seqDB search
MSYQQLPKDFLWGGAVAAHQVEGGWDKGGKGVSIADVLSGGSHGVDRVMTDGVLEGYRYP
NHEAVDFYSHYKEDIALFAEMGFKCFRTSIAWTRIFPHGDEQQPNEAGLQFYDDMFDELL
KYGIEPVITLSHFEMPWHLVKEYGGWKNRKVVDFFVKFSEVVMARYKSKVKYWMTFNEIN
NQRNWKYPLFGYCCSGVVFTEQENPEETLYQVLHHQFVASAKVVKLGHAINPEFKIGCMV
AMVPLYPFSCHPDDMMYSVEAMRERYLFGDVHMRGYYPSYILQEWARRGFNIHMEEGDLE
TLRDGCADYMGLSYYMSNAVSAINPGSGNSLSGFEGSVPNPHVKASDWGWQIDPVGLRYS
LSVLYERYQKPLFIVENGFGAIDKVAADGMVHDDYRIAYLKAHIEQMKKAVFEDGVDLMG
YTPWGCIDCVSFTTGEYSKRYGFIYVDKNDDGTGTMARSRKLSFDWYKKVIASNGEVL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcaacagttaccgaaagattttttatggggtggcgcggttgcggcacatcag
gttgaaggcggctgggataaaggcggcaaaggcgtgagcattgctgatgtcctctctggt
ggctcccatggggttgaccgtgtgatgacagacggagtactggaagggtatcgttatcca
aaccatgaagcagttgatttttatagccattacaaagaagacatcgcgctgtttgccgaa
atgggcttcaaatgtttccgcacctcaattgcctggactcgtatcttcccgcatggcgat
gaacagcaacccaatgaagccggcctgcaattttatgacgatatgttcgatgaattgctg
aaatacggtattgaaccggtgattacgttatctcacttcgaaatgccgtggcatctggtc
aaagaatatggtggctggaaaaaccgtaaagtggtcgatttctttgtaaaattcagtgaa
gtcgtcatggcgcgctacaaaagcaaagttaaatattggatgaccttcaacgagataaat
aaccagcgtaactggaaatatccactgtttggttattgctgttctggtgtggtgttcact
gaacaagagaacccagaagagaccctgtatcaggtactgcatcatcagtttgttgccagt
gccaaagtggtcaagctgggtcatgccattaatccggaatttaagattggctgtatggtg
gcgatggtgcctctgtatcctttctcctgccatccagatgacatgatgtattccgttgaa
gctatgcgtgagcgttatcttttcggcgacgttcatatgcgcggttattacccttcatat
attttacaagagtgggcgcgccgtggtttcaatatccatatggaagagggggacctcgag
actctgcgtgatggttgcgccgattacatggggctgagttattacatgagtaacgcggtc
tctgcgattaatccaggtagcggcaattcactctctggttttgagggcagcgtgccgaac
ccacacgtcaaagcctctgattgggggtggcagattgatccggtaggtctgcgttactct
ctgagtgtgttgtatgaacgctatcagaagccgctatttattgttgaaaatggttttggt
gcgatagataaagtggcagcggatggcatggtgcacgacgactaccgcattgcttatcta
aaagcccatatcgagcagatgaaaaaagcggtatttgaagatggcgtggatctaatgggt
tataccccatggggatgtattgactgcgtatctttcactaccggtgaatacagtaaacgt
tatggctttatttatgtcgataaaaacgatgatggcaccggtacaatggcgcgttcacgt
aagttaagttttgattggtataaaaaagttattgccagcaatggtgaagttctttaa

DBGET integrated database retrieval system