KEGG   Yersinia pestis D106004: YPD4_1338Help
Entry
YPD4_1338         CDS       T01832                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ypd  Yersinia pestis D106004
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YPD4_1338 (folE)
Enzymes [BR:ypd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     YPD4_1338 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1725272..1725934
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAELVHQALLARGLETPLRKPELDAETRKTRIQAHMTEVMHLLNLDLTDDSLAD
TPRRIAKMYVDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctaagtaaagaagctgagttggttcatcaagcgctgctggcccgtggtctt
gaaacccctttacgtaaaccagaattagatgccgagacgcgcaaaactcggattcaggcc
catatgacagaagtcatgcatttgctgaatcttgatttaaccgacgatagtctggctgat
acaccaagacgcattgcgaagatgtatgttgatgagattttctccggattggattacgaa
aatttccctaaaatcacactgattcaaaataaaatgaaagttgatgaaatggtaacggta
cgggatatcactctgaccagcacctgcgaacatcattttgtgacgattgatgggaaagcc
accgtcgcttatattccgaaagacagtgtcattggtttgtcgaaaatcaaccgtatcgtg
cagttttttgcgcagcgtccgcaagtgcaggaacgattaacacagcagatcttgctcgca
ttacaaaccctgttgggtaccaataatgtcgcagtttctattgatgcagttcattattgc
gttaaagcacgtggtatccgtgatgcgaccagcgcgacgaccaccacatcattaggcggg
ttatttaaatccagtcagaatacgcgtcaggaatttctgcgtgcggttcgtcaccacggc
tga

DBGET integrated database retrieval system