KEGG   Yersinia pestis D106004: YPD4_1777Help
Entry
YPD4_1777         CDS       T01832                                 

Definition
putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ypd  Yersinia pestis D106004
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ypd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2285699..2286532)
Genome map
AA seq 277 aa AA seqDB search
MFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQIRLLTPIAGVENEQNLIVRAAK
MLQKHPGNTPVPRGADISIDKCLPMGGGLGGGSSNAATVLVALNLLWQCGLTDEQLADLG
LTLGADVPVFVRGHAAFAEGIGEKLQPAEPVEKWYLVIHPGVNIPTPIIFSDPELKRNTP
IRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYAPSRLTGTGACVFAEFDTESSAR
QVLSIAPEWLHGFVARGVNVSPLHRVRSGKIESSERR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctttatatcaccgggcaacgcgccgacggctatcatcagttacaaacgctgttt
caatttcttgattatggtgatcaactgacgattgaaccgcgcgatgacaaccaaattcgc
ttattaacccccatagcaggggtggaaaatgagcaaaacctgatcgtccgcgcggcaaaa
atgctgcaaaaacaccctggcaatacccccgtgccacgcggtgctgatatcagcattgat
aaatgtttaccgatgggcggtggattggggggcggttcgtctaatgcagccacagtcttg
gtggcactcaacctactgtggcaatgtggtttaactgatgaacaattagccgatctcgga
ctaacattaggggctgatgtcccggtatttgttcggggccatgccgccttcgcagagggt
attggtgaaaaattacagccagcagagcctgtagagaagtggtatttggtcatacacccc
ggtgtaaacatcccaacaccgattattttttctgatcctgaattaaaaagaaatacgcca
atccgcccactggcggcgcttttaagcactccatacgcaaatgattgcgaaccgatcgca
agaaaacgttttcgcgaggttgaacaggctctttcatggctgttagaatacgccccgtca
cgccttaccggtaccggcgcttgtgtgtttgcagaattcgacacggagtcatcggcccgg
caggtgttaagtattgcccctgagtggttacatggttttgtcgcccgtggtgtaaatgtt
tcaccattgcatcgtgtacgctcagggaaaattgaaagcagtgagcgcagataa

DBGET integrated database retrieval system