KEGG   Yersinia pestis D106004: YPD4_1817Help
Entry
YPD4_1817         CDS       T01832                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ypd  Yersinia pestis D106004
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ypd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2332577..2333191
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETNGVGYEVQLPMTCFYELPELGQEAIIFTQFVVREDAQLL
YGFNNKQERALFRELIKVNGVGPKLALAILSGMSAQQFVGAVEREDITTLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNTGDISLPTASPQTSDADIEAEAASALVALGYKPQEASR
LVSKIAKPGADCETLIRDALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataggccgtctcagaggtatcattctggaaaaacagccaccgctggtgctgctggaa
acaaacggtgttggctatgaagtccaattaccaatgacctgcttctatgagttacccgag
ttggggcaggaagccattatcttcacccagtttgtggtacgcgaagatgcgcagttactg
tatggtttcaataataagcaggagcgggcgctgttccgtgaattgatcaaagttaacggc
gtcgggccaaaactggctttagccattctctccgggatgtctgcacagcaatttgttggc
gcagtcgaacgtgaagatattacaacgctggtaaaactgccgggtgtcggtaaaaagacc
gccgagcggttagtggtcgaaatgaaagatcgctttaaaggccttaacggcgatctgttt
aataataccggtgatatctcgttaccaacggcttcgccacaaacctcggatgctgatatc
gaagcggaagccgcttctgcactggtcgcgctgggttataaaccacaagaggccagccgt
ttagtgagtaaaattgccaagccgggtgccgattgtgaaacactgatccgtgatgctctc
cgtgcggcgttataa

DBGET integrated database retrieval system