KEGG   Yersinia pestis D106004: YPD4_1848Help
Entry
YPD4_1848         CDS       T01832                                 

Definition
putative phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ypd  Yersinia pestis D106004
Brite
Enzymes [BR:ypd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     YPD4_1848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2368207..2368719
Genome map
AA seq 170 aa AA seqDB search
MATIKRIASGSACAVAVIIAIVISAGNVRTSERGLELIGNAESCRRDPYACPAGVLTDGI
GNTHGVKAGVIKTDTQIAEDWEKNILDAERCVIRYANGNKLPPSAFDAATSISFNAGCSL
MQKSTMFKYFRAGNVTAACEQFPRWIYGGGKKLPGLVTRREKEKALCLES
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaataaaacgcattgcctccgggtctgcttgtgctgttgcagtcatcatcgcg
attgttatttcggcgggcaacgtaagaactagcgaacgaggacttgagctgatcggcaat
gctgaatcatgccgccgcgacccatacgcttgtccggctggagtactgactgatggcatt
ggcaacactcatggcgtcaaggctggagttattaagaccgacactcagatagccgaagat
tgggaaaagaacattcttgatgctgaacgctgcgtcattcgctatgcaaatggcaataaa
ttaccgcccagcgcttttgatgccgctacgtcaatcagctttaacgccggttgctcattg
atgcagaaatccacaatgttcaagtattttcgcgctggtaacgtgacagcggcctgtgaa
cagttcccgcgctggatatatggtggcggtaaaaaattgccggggctggtgactcgtcgc
gagaaggagaaggcgctatgcctggaaagttaa

DBGET integrated database retrieval system