KEGG   Yersinia pestis D106004: YPD4_1917Help
Entry
YPD4_1917         CDS       T01832                                 

Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ypd  Yersinia pestis D106004
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    YPD4_1917
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPD4_1917
   00620 Pyruvate metabolism
    YPD4_1917
   00650 Butanoate metabolism
    YPD4_1917
  Lipid metabolism
   00071 Fatty acid degradation
    YPD4_1917
  Amino acid metabolism
   00350 Tyrosine metabolism
    YPD4_1917
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YPD4_1917
   00626 Naphthalene degradation
    YPD4_1917
Enzymes [BR:ypd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YPD4_1917
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     YPD4_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2449507..2451477)
Genome map
AA seq 656 aa AA seqDB search
MSKTFDNGVICASEQSIIVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGGLNAA
IVGQPATKIAEMAGIKVPSNTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKNFEEAVEK
AEKLVEMGGIGHTSCLYTDQDNQTARVKYFGDKMKTARILINTPASQGGIGDLYNFKLAP
SLTLGCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVA
TDGAKRAFIVTDRYLFNNGYADQVTSVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSF
KPDVIIALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKLVAI
TTTSGTGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAV
THALEAYVSVLANEYSDGQALQALKLLKEFLPASYNEGAKNPVARERVHNAATIAGIAFA
NAFLGVCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRY
AEIADHLGLSAPGDRTAQKIQKLLAWLDEIKAELGIPASIREAGVQEADFLAKVDKLSED
AFDDQCTGANPRYPLISELKQILMDTYYGREYVEEFDREEEVAAATAPKAEKKTKK
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaacctttgataacggtgttatctgcgcgtcagagcagtccatcatcgttgtt
gactcggtttacgatgcggttcgcgagcgttttgcttctcatggtggctacctgttacaa
ggtaaagaattgaaagccgttcaggatattatcctgaaaaatggcggtctaaacgcagcc
atcgtgggccagccagcaactaagatcgctgagatggctggcattaaagtgccaagtaat
accaagatacttatcggtgaagtcaaagttgtcgatgaatcagagccatttgctcatgaa
aaactgtcgcctacactggcaatgtatcgtgctaaaaactttgaagaagcggttgaaaaa
gcagagaaactggtggagatgggcggtatcggtcatacctcttgtctgtacaccgaccaa
gataaccagactgcacgcgttaaatatttcggcgataaaatgaagaccgcccgaattcta
atcaacacccctgcctctcaaggtggtatcggtgacttgtataacttcaagctggcaccg
tctctgacgctgggttgtggttcttggggtggtaactccatctctgaaaacgtcggtccg
aaacacttgatcaacaagaaaactgtggctaagcgagcagaaaacatgttgtggcataaa
ctaccgaaatctatttacttccgtcgcggctctctgcctatagcgttggaagaagtggca
actgacggtgcaaaacgtgccttcatcgtgactgaccgctacttgttcaacaacggttat
gcagaccaagtcaccagcgtactgaaatctcacggtattgaaactgaagttttcttcgaa
gtagaagctgaccctaccctgagtatcgtgcgtaaaggtgcagagcagatgaactccttc
aagccagacgttattattgctctgggtggtggttcaccgatggatgctgcaaaaatcatg
tgggtaatgtacgaacatcctgaaacgcatttcgaagaactggcattgcgttttatggat
atccgtaaacgcatttataagttcccgaaaatgggtgtaaaagcgaaattggtcgctatt
acaaccacatcaggtaccggttcagaagtcaccccgtttgctgtggttactgatgacgca
acaggccagaaatatccattggcagactatgcattgacaccagatatggccattgttgat
gccaaccttgttatgaatatgcctaagtctctgtgtgccttcggtggtctggatgcagta
acgcacgcactggaagcctatgtgtctgtactggctaatgaatactctgacggccaggcg
ctgcaagcactgaagctgttgaaagaattcttgccagccagctacaacgaaggggctaaa
aacccagttgctcgcgaacgtgtacataatgcagcaacaattgccggtatcgcctttgct
aacgccttcttgggtgtctgtcactctatggcccacaaactgggttctgagttccatatc
ccacacggcttggcaaatgctatgttgatttctaacgttattcgctacaacgcgaatgac
aacccaacaaaacagactgccttcagccaatatgaccgcccacaagcgcgtcgtcgttat
gcagaaattgcagatcatttggggctgagtgcaccgggcgaccgtactgcacaaaaaatc
cagaaactgctggcttggttagatgaaatcaaagctgaactgggtatcccggcatcgatt
cgcgaagcgggtgttcaggaagctgacttcttagctaaagtagacaaattgtctgaagat
gcatttgatgaccagtgcacaggtgctaacccacgctacccactgatctcagagctgaaa
cagatccttatggatacttattacggtcgcgaatatgttgaagagtttgaccgcgaagaa
gaagtcgcggcagctactgcgcctaaagctgagaaaaagaccaaaaagtaa

DBGET integrated database retrieval system