KEGG   Yersinia pestis D106004: YPD4_1937Help
Entry
YPD4_1937         CDS       T01832                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00260  Glycine, serine and threonine metabolism
ypd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypd01100  Metabolic pathways
ypd01110  Biosynthesis of secondary metabolites
ypd01130  Biosynthesis of antibiotics
ypd01230  Biosynthesis of amino acids
Module
ypd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPD4_1937 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YPD4_1937 (trpA)
Enzymes [BR:ypd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YPD4_1937 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NMO His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACY58844
Position
complement(2474325..2475131)
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFKQLAAKKEGAFVPFVQLGDPSPAMSLNIIDTLIAAGADALELGIPFSDPLAD
GPTIQNAALRAFAAGVTPGICFEILAEIRQKHPTIPIGLLMYANLVFHNGIDHFYQRCAE
VGVDSVLIADVPFEESAPFRAAALRHGIAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGAENHGQLPLNHLVDKLREYNAAPALQGFGISEPAQVKASLAAGAAGAISGSAIVKI
IEKNVAQPVEMLVQLTRFVTEMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcagcaactttttaagcagttagccgccaaaaaagaaggtgcctttgtt
cctttcgtccagcttggcgatccctctccggcgatgtcactcaatattattgatacgtta
attgcggcaggtgcagatgcattagagttagggattccgttctctgatccgttggctgat
ggccctaccatacaaaatgcggcgctgcgtgcctttgctgcgggtgtcactccgggtatt
tgttttgaaatactggccgaaatccgccaaaaacaccccacaatacctattggcctgttg
atgtatgcaaatctggtattccacaatggtattgatcacttctaccagcgctgtgctgag
gtgggtgtcgattcggtgctaattgctgatgtgccatttgaagagtctgcccctttccgg
gcagcggccttacgtcacgggattgcacccattttcatctgcccgcctaatgccgacgat
gacttactgcgagaaatcgcttctcatggtcgtggttatacttacctgttatcacgtgcc
ggagtcaccggtgcagaaaatcacggccagttaccgttaaaccatctggtagataaactg
cgtgaatataatgcagcgcccgcattgcagggctttggtatttcagaacccgcgcaagta
aaagccagcctggcggcgggcgcggcgggtgctatttcaggctcagcaatcgtcaaaatc
attgaaaaaaatgttgcacaacccgttgaaatgttagttcagctaacccgcttcgtcaca
gagatgaaagcggcaacccgcagctag

DBGET integrated database retrieval system