KEGG   Yersinia pestis D106004: YPD4_1939Help
Entry
YPD4_1939         CDS       T01832                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ypd  Yersinia pestis D106004
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ypd01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ypd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2476478..2477905)
Genome map
AA seq 475 aa AA seqDB search
MQETGGYKTEGYNVGSDKVDSDKTKTVLHQIVHDKEIWVAARKLQQPLTRFQNEITQSQR
DFYHALQGDKTVFILECKKASPSKGVIRDNFNPAEIAGVYKHYASAISVLTDEKYFQGSF
DFLPQVSAAVTQPVLCKDFIIDAYQIQLARFYHADAILLMLSVLDDEAYRQLAAVAHSLN
MGVLTEASNAEELERAITLGAKVVGINNRDLRDLSIDLNRTRELAPRLPEGVTIISESGI
SHYRQVRELSQFANGFLIGSALMSEPDLNAAVRRVLLGENKVCGLTRAQDAATAYHAGAV
YGGLIFVDSSPRYVDIASARTVISGAPLKYVGVFRHAEIETVRQTAEQLSLAAVQLHGHE
DQQYINQLRKVLPADCQIWKALSVGDTMPERNLQQVERYVLDHGTGGTGQRFDWSLLADQ
ALDNVLLAGGLGPDNCDVAAQLGCAGLDVNSGVESAPGIKDPQRIAAVFQALRVY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaactgggggttacaaaaccgagggttataacgttggcagtgacaaagttgac
agtgataaaaccaaaaccgtgctccaccaaatcgtacacgataaagaaatttgggttgcc
gcgcggaaactgcaacagcctctaacccgcttccaaaacgaaatcacccagagtcagcgc
gatttttatcacgcgctacaaggcgataaaacggtctttattttggaatgcaaaaaagcc
tcaccttctaaaggggttatccgtgacaactttaacccggcggagattgccggtgtttat
aagcactatgcgtcggctatctcagtattaacggatgagaaatatttccagggcagtttt
gatttcttgccacaagtcagtgccgccgtcactcagccggtattgtgtaaagattttatt
attgatgcttatcagattcagctagcgcggttttaccacgctgacgccattttactgatg
ctgtcggtcttggacgatgaggcttaccgccaattggccgccgtcgcacacagcctgaac
atgggggtgttgaccgaagccagtaacgccgaagaattggagcgtgctattaccttgggt
gccaaagttgttggcatcaataaccgcgacctgcgtgacctgtctatcgatctgaatcgc
acccgtgaattggcaccacgcctaccagaaggtgtcacaataatcagtgaatctggcatt
agtcattatcgtcaggtccgtgaattgagccaatttgccaacggtttcctgattggcagt
gccctgatgtccgaacccgatctcaacgcggccgtccgccgggtgttactgggcgaaaat
aaagtttgcggcctgacacgcgcacaagatgccgccacggcttaccacgcaggtgcggtg
tacggcgggttgatttttgtcgacagttcaccccggtatgtggatatcgccagcgcccgt
acggttatcagtggtgcgccgctaaagtatgtcggtgtttttcgtcatgctgaaatagaa
actgtacggcaaacggctgaacaactctcactggcagcagtgcaattgcatgggcatgaa
gatcaacagtatatcaatcaactgcgcaaagtattacctgcggattgccagatttggaag
gcactgagtgtcggtgacacgatgccggaacgcaacttacagcaagttgaacgctacgta
ttggatcacggtacgggtggcacagggcaacgtttcgactggtcattattggcagatcaa
gcactagataatgtcttgctggcaggcggcttggggccagataactgtgatgtggcagcc
caactaggctgtgccgggctggatgtcaattccggcgtagaaagcgcccctggcatcaaa
gacccccaacggatcgccgctgtattccaggcattacgcgtgtactga

DBGET integrated database retrieval system