KEGG   Yersinia pestis D106004: YPD4_2115Help
Entry
YPD4_2115         CDS       T01832                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ypd  Yersinia pestis D106004
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ypd00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ypd00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2714826..2715848)
Genome map
AA seq 340 aa AA seqDB search
MMLDVASYELDAEEREILKHPLVGGLILFSRNFHDAEQLRELVRQIRAASHERLVVAVDQ
EGGRVQRFRDGFTRLPAAQYFAAINDAATAAQLAQEAGWLMAAEMMAMDIDISFAPVLDI
GHVSAAIGERSFHSDPQQARIMAECFIRGMHSAGMKTTGKHFPGHGAVTADSHKETPHDN
RPLAEIRTHDMVIFRELIQRKLLDAIMPAHVIYTEADARPASGSAYWLQEILRQELGFEG
IIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGAVSVLDNLSPIKADQLTRL
YHSGQFDRQTLMASSRWQQANKALTALSERWDAHKQTLGQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgatgttagatgttgccagctatgagctggatgctgaagagcgtgagattttaaaacac
ccactggtgggagggttgatcttattcagccgtaattttcatgatgcggagcagttacgc
gaattagtacgccaaatccgtgcagcatcgcatgaacgtttggtggtcgcagtggatcag
gaaggggggcgggtccaacgctttcgtgacggttttacccgcctgccagcggctcagtat
ttcgcggctatcaatgatgccgctactgcggctcaactggcgcaagaggcggggtggttg
atggcagcagaaatgatggcgatggatatcgatatcagttttgctccagtactggatatt
ggccatgtcagcgccgcaattggtgagcgttcattccacagtgatccacaacaggcgcgg
ataatggcggagtgtttcatccgtgggatgcacagtgcagggatgaaaaccacgggcaag
cattttccagggcacggcgcagtaaccgcagattcacataaagagacgccacatgataat
cggccactggcagaaatccgtactcatgatatggttatatttcgtgaattgatccagcgg
aaattactggatgcgattatgcctgctcacgtgatttataccgaagccgatgcacggcct
gccagcggttctgcctattggttacaagagatattgcgccaagagctagggttcgagggc
atcattttctctgatgatctctcgatggaaggggctgcgatcatgggcagttacgccgag
cgcggccaggcatcgttggatgccggttgcgatatgattttggtgtgtaataaccgtcag
ggggccgtgagtgtgctggataatctgtctccgatcaaagccgaccaactgacccgtttg
taccattcagggcaatttgaccgccagacattgatggcttcatcccgttggcaacaggcg
aataaagcattaacggcactcagcgaacgttgggatgcacataaacaaacgttggggcaa
tag

DBGET integrated database retrieval system