KEGG   Yersinia pestis D106004: YPD4_2454Help
Entry
YPD4_2454         CDS       T01832                                 

Gene name
aat
Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00220  Arginine biosynthesis
ypd00250  Alanine, aspartate and glutamate metabolism
ypd00290  Valine, leucine and isoleucine biosynthesis
ypd01100  Metabolic pathways
ypd01110  Biosynthesis of secondary metabolites
ypd01130  Biosynthesis of antibiotics
ypd01210  2-Oxocarboxylic acid metabolism
ypd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YPD4_2454 (aat)
   00290 Valine, leucine and isoleucine biosynthesis
    YPD4_2454 (aat)
   00220 Arginine biosynthesis
    YPD4_2454 (aat)
Enzymes [BR:ypd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     YPD4_2454 (aat)
    2.6.1.66  valine---pyruvate transaminase
     YPD4_2454 (aat)
Amino acid related enzymes [BR:ypd01007]
 Aminotransferase (transaminase)
  Class I
   YPD4_2454 (aat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACY59361
Position
complement(3135934..3137148)
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLFSARKAIMQHYQARNIRDLTVEDIYIGNGVSELIVQSMQALLNLGD
EMLVPAPDYPLWTAAVSLSSGKAIHYMCDEESGWFPDLDDIRSKITPRTRGIVIINPNNP
TGAVYSKELLLEIVEIARQNDLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
QPGGRLYEQRDRAWELINQIPGVSCVKPQGALYMFPRIDQKRFNLKDDQKLVLDLLLQEK
VLLVQGSAFNWPYPDHVRIVTLPRVDELEMAVRKLGRFLETYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgagaaatccagcaaactggacaacgtctgttatgacattcgtggaccg
gtgctaaaagaagctaagcgtcttgaagaggaaggtaacaaggttctgaaactgaacatc
ggcaaccctgccccgtttggtttcgatgcacccgacgagattctggtggatgtaatccgt
aatttaccgaccgcacaaggctattgcgactccaaaggcttgttttcggcacgtaaagcc
attatgcaacactatcaagcccgcaatatccgtgatctgacggtcgaggatatctacatt
ggaaacggtgtttccgagttgatcgttcaatccatgcaagcattactgaatttgggtgat
gaaatgctagtacccgcaccggattacccgctgtggacagctgccgtgtcgctctcaagt
ggtaaagcgattcattatatgtgtgatgaagagtcaggctggttccctgatttggatgat
attcgcagcaaaatcactccgcgtacccgtgggattgtgattatcaacccgaataaccca
accggtgcggtatacagcaaagagctgctgttagaaattgttgaaattgctcgccagaat
gacctaattattttcgctgatgagatctacgataaaattttgtatgacgatgctcagcac
cattcgatcgccgcattagcccctgatttgctgaccgttacgttcaatgggctgtctaaa
acataccgtgttgcgggtttccgccagggctggatggtgttgaacgggccgaaaaagcac
gctaaagggtatattgaaggcttggaaatgctggcatcgatgcgtttgtgcgccaacgta
ccaatgcagcatgcgattcaaaccgccttgggcggctatcagagcattagtgagtttatc
caacctggtggccgtttgtacgagcagcgtgatcgggcctgggagcttatcaaccaaatc
cccggtgtttcctgtgtgaaacctcagggcgcgttgtatatgttcccacgtattgatcag
aaacgttttaacctgaaagacgaccagaagttggtattggatctgttgttgcaagagaaa
gtgctattggtgcaaggtagcgcctttaactggccgtacccggaccatgtgcggatcgtc
acgctgccacgggtggatgagctagagatggcggtgaggaagctggggcggttcttagag
acgtatcatcagtaa

DBGET integrated database retrieval system