KEGG   Yersinia pestis D106004: YPD4_2676Help
Entry
YPD4_2676         CDS       T01832                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ypd  Yersinia pestis D106004
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YPD4_2676
  Amino acid metabolism
   00300 Lysine biosynthesis
    YPD4_2676
Enzymes [BR:ypd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     YPD4_2676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3408111..3409028
Genome map
AA seq 305 aa AA seqDB search
MICPVIELAQQLIKRPSLSPSDAGCQEIMIQRLAAIGFTIEPMNFGDTLNFWAWRGEGET
LAFAGHTDVVPTGDESHWHSPPFEPTIRDGMLYGRGAADMKGSLAAMIVAAERFVAAHPD
HKGRLAFMITSDEEAKATNGTVKVVEALMARHERLDYCLVGEPSSTDRVGDIVKNGRRGS
ITANLRIHGVQGHVAYPHLADNPVHRAMPALNELVATQWDEGNAFFPATSMQIANLQAGT
GSNNVIPGEFYVQFNFRFSTELTDSLIKQRVAALLDRHQLDYYPGMGIVWSTFPDRQRGV
GGCRG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtccggtaatcgaattggcccaacagttaattaaacgcccatcgctcagccct
tcagatgcgggttgccaagagatcatgatccagcgcctagccgccatcggctttaccatc
gaacccatgaattttggtgatacgcttaatttttgggcatggcgtggcgaaggcgaaacg
ctggcatttgctggtcacacggatgtggtgcctaccggtgacgagagccactggcacagc
ccaccgtttgaacccaccatccgtgacggcatgttgtatggccgaggtgccgcagacatg
aaaggctcactggcagcaatgatcgtagcagccgagcgttttgtcgccgcgcaccctgac
cacaaaggccgcctggcctttatgataacctccgatgaagaagccaaagccaccaacggt
acagtaaaagtggttgaagccctgatggcacgccacgagcggctggattattgtctggtg
ggcgaaccatccagtactgaccgggttggcgatatcgtgaaaaatggccgccgtggctcc
atcaccgctaacttgcgtattcatggagtgcaagggcacgtggcgtatcctcatctggcg
gataatcccgttcatcgtgctatgccagcgctgaatgaattggttgccacccaatgggat
gaaggcaatgcgtttttccctgccaccagtatgcaaattgccaatttacaggccggtacg
ggcagcaataatgttattcccggtgaattttatgtgcagtttaacttccgtttcagtact
gaactgactgacagcctgatcaagcaacgggtagccgcattgctggatcgacatcagctt
gattactaccctggaatgggtattgtctggtcaacctttcctgaccgccaaaggggcgtt
ggtggatgccgtggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system