KEGG   Yersinia pestis D106004: YPD4_2676Help
Entry
YPD4_2676         CDS       T01832                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ypd  Yersinia pestis D106004
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ypd01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ypd00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3408111..3409028
Genome map
AA seq 305 aa AA seqDB search
MICPVIELAQQLIKRPSLSPSDAGCQEIMIQRLAAIGFTIEPMNFGDTLNFWAWRGEGET
LAFAGHTDVVPTGDESHWHSPPFEPTIRDGMLYGRGAADMKGSLAAMIVAAERFVAAHPD
HKGRLAFMITSDEEAKATNGTVKVVEALMARHERLDYCLVGEPSSTDRVGDIVKNGRRGS
ITANLRIHGVQGHVAYPHLADNPVHRAMPALNELVATQWDEGNAFFPATSMQIANLQAGT
GSNNVIPGEFYVQFNFRFSTELTDSLIKQRVAALLDRHQLDYYPGMGIVWSTFPDRQRGV
GGCRG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtccggtaatcgaattggcccaacagttaattaaacgcccatcgctcagccct
tcagatgcgggttgccaagagatcatgatccagcgcctagccgccatcggctttaccatc
gaacccatgaattttggtgatacgcttaatttttgggcatggcgtggcgaaggcgaaacg
ctggcatttgctggtcacacggatgtggtgcctaccggtgacgagagccactggcacagc
ccaccgtttgaacccaccatccgtgacggcatgttgtatggccgaggtgccgcagacatg
aaaggctcactggcagcaatgatcgtagcagccgagcgttttgtcgccgcgcaccctgac
cacaaaggccgcctggcctttatgataacctccgatgaagaagccaaagccaccaacggt
acagtaaaagtggttgaagccctgatggcacgccacgagcggctggattattgtctggtg
ggcgaaccatccagtactgaccgggttggcgatatcgtgaaaaatggccgccgtggctcc
atcaccgctaacttgcgtattcatggagtgcaagggcacgtggcgtatcctcatctggcg
gataatcccgttcatcgtgctatgccagcgctgaatgaattggttgccacccaatgggat
gaaggcaatgcgtttttccctgccaccagtatgcaaattgccaatttacaggccggtacg
ggcagcaataatgttattcccggtgaattttatgtgcagtttaacttccgtttcagtact
gaactgactgacagcctgatcaagcaacgggtagccgcattgctggatcgacatcagctt
gattactaccctggaatgggtattgtctggtcaacctttcctgaccgccaaaggggcgtt
ggtggatgccgtggttaa

DBGET integrated database retrieval system