KEGG   Yersinia pestis D106004: YPD4_2702Help
Entry
YPD4_2702         CDS       T01832                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypd  Yersinia pestis D106004
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YPD4_2702
Enzymes [BR:ypd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YPD4_2702
   3.1.2  Thioester hydrolases
    3.1.2.-  
     YPD4_2702
Lipid biosynthesis proteins [BR:ypd01004]
 Fatty acid synthase
  Component type
   YPD4_2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3433819..3434454
Genome map
AA seq 211 aa AA seqDB search
MNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQAT
PSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDLSEI
INQITAAKAQPLLMQIRIPPNYGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEWM
QDDGLHPNGDAQPFIADWMAQQLKPLVVDPK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaacgttttccgctggcatcttcccttccttttactgttgggattattc
agtttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgccggt
taccgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagccacg
ccttcattaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaagggcta
gcgcgcttacccgctctactcaaacaacatcagccacgctgggtgctgattgaactgggc
gccaatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatctgagcgaaatt
atcaatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattccccct
aactatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaacag
ttcgacatccccctactccctttttttatggaacaggttgccgttaagccagagtggatg
caggatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatggcg
caacaactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system