KEGG   Yersinia pestis D106004: YPD4_2737Help
Entry
YPD4_2737         CDS       T01832                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ypd  Yersinia pestis D106004
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ypd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3475371..3475946)
Genome map
AA seq 191 aa AA seqDB search
MEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEHCT
ICLNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGPGDIGLDLLEK
RLSTEAISEVILATNPTVEGDATANYIGQMCGQYGILASRIAHGVPVGGELEMVDGTTLS
HSLAGRNPIKY
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgttgcgttgtttaccgggtgttggcccgaaatcggcgcaacgtatggcattt
cagctattacagcgcgatcgtagtggtggaatgcgcctggcgcaggctctgacacgggca
atgtctgaaataggccattgtgcagattgtcgtacatttaccgagcaagagcactgcacc
atctgcttgaatccccgccgtcaacaaaatggtcaaatctgtgtggtcgaaagcccggca
gatatccatgccattgagcaaactggccagtttggcgggcgttattttgtgctgatgggg
catttatcacctatggatggtattggccctggtgatatagggctagatctactggagaaa
cggctttctactgaggctatcagtgaggtcattttagccacgaatccaaccgttgaaggg
gatgcaacagccaactatatcggccagatgtgtggccaatatggcatactggccagccgc
atcgcccatggcgttcctgttggtggcgagttagaaatggttgatggcaccacgttatct
cactcgttagcagggcgtaatcccatcaagtactga

DBGET integrated database retrieval system