KEGG   Yersinia pestis D106004: YPD4_2819Help
Entry
YPD4_2819         CDS       T01832                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00330  Arginine and proline metabolism
ypd00332  Carbapenem biosynthesis
ypd01100  Metabolic pathways
ypd01130  Biosynthesis of antibiotics
ypd01230  Biosynthesis of amino acids
Module
ypd_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    YPD4_2819 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    YPD4_2819 (proB)
Enzymes [BR:ypd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     YPD4_2819 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACY59726
Position
complement(3578611..3579714)
Genome map
AA seq 367 aa AA seqDB search
MSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAKGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADLEDRERFLNARDT
MNALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILASADKLLLLTDQAGLYTADPR
NNPEAELIREVHGIDDVLRGMAGDSVSGLGTGGMATKLQAADVACRAGIDVVIAAGSQVG
VIADVIDGTPVGTRFHSLETPLENRKRWIFGAPPAGEITVDDGAVFAIMERGSSLLPKGI
RSVKGDFSRGEVIRIRNLNGRDLAHGVSRYNSDALRMLAGHHSQQISEILGYEYGPVAVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcagccagacattggttgtgaaattggggacgagtgtactgaccgggggttcc
cgccgtcttaaccgtgcccatattgttgaattggtgcgtcaatgtgcccagcaacacgca
aaaggtcatcgtattgttattgtcacctctggggcgattgctgcgggtcgtgaacattta
gggtatccagagttgcccgccactattgcctcgaaacaattgctagccgcggttgggcaa
agccggttaattcagctctgggaacaactgttttcaatttatggcattcatatcggccag
atgctgctaacccgcgcagatttagaggatcgtgagcgttttcttaatgcccgcgatacc
atgaatgcgttgcttgataaccgcattgtaccggtgatcaatgagaacgacgccgtcgct
actgctgaaatcaaagtgggcgataacgataatctctccgcattggcggccattttggcc
agtgcagataagctactgttgttgaccgatcaggcggggttgtacaccgctgatccgcgt
aacaatccagaagcggagttaattcgcgaagtgcatggcattgatgatgtcctgcgcggg
atggccggagacagcgtttcggggctcgggacggggggcatggcgactaaactgcaagcg
gcggatgtcgcgtgccgtgcgggtattgatgtggtgattgccgcaggtagccaggtgggt
gtgattgccgatgtgattgacggtacgccagtcggtacccgtttccactcattggaaaca
ccattagaaaaccgtaaacgttggatttttggtgcgccaccggcaggtgaaatcacagtg
gacgacggtgctgtatttgcgatcatggaacggggcagttcgctgctgccaaaaggcatt
cgcagcgttaaaggggacttctcccgtggtgaagtgatccgtatccgtaatctcaatggg
cgggatttagcacacggtgtttcacgctataacagtgatgcattgcgcatgttagcgggg
catcactcgcaacaaatcagtgaaatcctcggatatgaatacggcccggtggctgttcat
cgtgatgatatgattgtcagctaa

DBGET integrated database retrieval system