KEGG   Yersinia pestis D106004: YPD4_3226Help
Entry
YPD4_3226         CDS       T01832                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ypd  Yersinia pestis D106004
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ypd00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4084068..4084808
Genome map
AA seq 246 aa AA seqDB search
MLEQIGQLAREAGVAIMAVYQGDKPLDIAHKKDDSPVTAADLAAHQIIKAGLARLTPDIP
LLSEEDPPAWDVRQHWQRYWLVDPLDGTKEFLNRNGEFTVNIALIDQGEPVLGVVYVPVT
EVMYSAANGQAWKEECGRRMQIQVRDAQPPLVVVSRSHSDAELEDYLSQLGEHQTISVGS
SLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVHDWQGKTLSYTPRESFLNPG
FRVSLF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaattggccagttggcccgtgaggcaggcgtggcgattatggcggtctat
cagggcgacaaaccccttgatattgcgcataaaaaggatgattcaccggtgacggcggct
gatttggcggctcaccagattatcaaagctgggttggcgcgattaaccccggatattccg
ctactctctgaagaggatccacccgcttgggatgtgcgccagcactggcaacgctactgg
ctggttgacccgctggacggtactaaagagttcctcaatcgtaacggtgaattcaccgtc
aacatcgctttgattgaccaaggtgaaccggtactgggcgtcgtctatgtaccggtaacc
gaagtgatgtacagcgcggcaaacggacaggcttggaaagaagagtgtggcagacgtatg
cagattcaggtgcgtgatgcccagcctccgttggtcgtggtgagccgctctcacagcgat
gctgaattggaagactatttatcacaactgggggagcatcaaactatttcggtgggctca
tcacttaaattctgcttggtggcggaagggaaagcgcaactgtacccgcgttttgggcca
actaacgtctgggatacggcggctggtcatgccgtcgccatcgctgccggggcgcaagta
cacgattggcagggaaagacactgtcttataccccacgtgaatctttcttgaaccccggt
ttcagagtttcgttattttag

DBGET integrated database retrieval system