KEGG   Yersinia pestis D106004: YPD4_3250Help
Entry
YPD4_3250         CDS       T01832                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00790  Folate biosynthesis
ypd01100  Metabolic pathways
Module
ypd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YPD4_3250 (folP)
Enzymes [BR:ypd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     YPD4_3250 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind KdpA
Motif
Other DBs
NCBI-ProteinID: ACY60154
Structure
PDB: 

Jmol
Position
4113494..4114327
Genome map
AA seq 277 aa AA seqDB search
MHLTARGLTLDLSRPQVMGILNVTPDSFSDGGCHNNLDQALQHAQRMLSAGATLIDIGGE
STRPGAAEVSEQEELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSL
QEPGALEAAAKTGLPVCLMHMQGQPKNMQHSPYYDDLMTDINRFFQHHIERCVAAGIAKN
KLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSV
ACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSAKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcatctaactgccagaggtctgacgttggatctctctcgtccacaagtcatgggtatt
ctgaatgtcacaccagattcattttcagatggtgggtgtcacaataaccttgatcaagca
ttgcaacatgctcaacggatgttatcagcaggcgctacgctgattgatatcggtggtgaa
tcaacgcgccctggggctgctgaagtcagtgagcaagaagaacttgatcgagtcgtgcct
gtggttgaggcgttagctcagcgttttgatgtgtggctctcggtagacacgtctaaagcc
gctgttatcactgaatctgctcatgcaggtgcccatctaattaatgatatccgctcgttg
caagagcctggcgctcttgaagcagcggcaaagactggcttaccggtgtgcctaatgcat
atgcaggggcaaccgaaaaatatgcagcattcaccctactatgatgatttaatgaccgat
ataaatcggttcttccaacatcatattgaacgctgtgttgcggcaggtatcgcaaaaaat
aaattgttgctcgacccaggcttcggtttcggtaaaaatctggcgcataattaccaacta
ttggcacatctgtcagagcttcaccattttgagttgccattattggtcggaatgtcgaga
aaatcgatggtaggccaattattgaatgtaccaccacaacagcgtgtcatcgggagtgtt
gcttgtgcggtgattgctgccatgcaaggtgcgcagattatcagagtgcatgatgtcaaa
gaaactgtcgaggcgatgtgtatcgtcgaggcaacacgttcagcgaagggataa

DBGET integrated database retrieval system