KEGG   Yersinia pestis D106004: YPD4_3396Help
Entry
YPD4_3396         CDS       T01832                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthetase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ypd  Yersinia pestis D106004
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ypd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4307425..4308174
Genome map
AA seq 249 aa AA seqDB search
MTILVTRPSPAGEQLVTRLRALGRVAYHAPLIDFSPGRDLPKLPELLQDMQAGDLVFALS
QNAVRYANPLLKRNKLSWPVQLSYYAIGRTTALALHTASRLHVTFPPMGETSEMLLSLPL
LQNLAGKKALLLRGNGGRELLGASLAERGAAVTFCECYQRSPIYYDGSEQSAHWQRAGVD
ILVVTSGEMLQQIYTLVPDYYRSSWLLRCRLIVVSDRLAALATQMGWTEVRVAENADNDA
LIRALQDLQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcctggtcacccgtccatcccctgctggggagcaattagtcactcgcctgcgt
gctctgggccgggttgcctaccatgcgccattgattgatttttccccaggaagagacctg
cccaaactgccggaattattgcaagatatgcaagcgggagacttggtttttgctttatca
cagaacgcggtccgctacgctaacccgctgttaaaaagaaataaactgtcatggcctgtg
cagttatcttattatgctattggccgtacaaccgcattagcactgcataccgccagccgt
ttgcatgtcactttcccaccaatgggggagaccagtgaaatgctgctatcattgcccctg
ctgcaaaatttggccggtaaaaaggcactgttattacgcggtaatgggggccgggagttg
ctaggcgcaagcctcgcagaacgcggagcggccgtgaccttctgcgaatgctatcaacgc
agtcccatctattatgatggcagcgaacaaagtgctcactggcaacgtgccggtgttgat
attctggtggtcaccagcggcgaaatgttacaacagatctatactttagttcctgattac
tatcgttcttcctggttactgcgttgccgtttaatcgttgtgagtgatcgtttagcggcc
ttagccacccaaatggggtggacggaggtccgggtagcagaaaatgccgataatgacgca
ctgatccgtgcgttacaagaccttcaataa

DBGET integrated database retrieval system