KEGG   Yersinia pestis D106004: YPD4_3517Help
Entry
YPD4_3517         CDS       T01832                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ypd  Yersinia pestis D106004
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPD4_3517
Enzymes [BR:ypd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     YPD4_3517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4493235..4494134)
Genome map
AA seq 299 aa AA seqDB search
MFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADILIAYNLLEAGRL
WGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLNPSYLPPQLLARF
SSIDGPWEAMVEVNQRMWLETAPNGFSLDWVVWQKGKGWQPDTIKPDVGSNDAILVYLWA
GMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGAVGFSAALLPFLASS
PEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQGELQPSWHRQR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagcgtttattggcttggacagaaaacaatctggcagccggtgatctcacttcc
cgccttcccgcttggttatgggggcaaaactcacaaaataactgggatattctggaccct
aattcggcctccgatgcggatatcttgattgcctacaacttgctggaggctggcaggtta
tggggtaaccgccgttacctgattatgggtaccttattactgcaacgtattgcgcaagaa
gaagtcatggatattcccggccttggccagatgctattaccgggaaaaattggttttaac
gatgaggatacctggcgtctcaacccaagttatttaccgccacaactactggcacgattt
tcctccatagacgggccttgggaagcgatggtagaagtgaatcagcgtatgtggctggaa
accgcaccaaacggtttttcgctggactgggtggtctggcagaaaggtaaaggctggcag
cccgataccataaaaccggatgtcggcagtaacgatgccattctggtttatctgtgggcg
gggatgctggcaatggacagcccacaaaaagctgaattgattgcgcgttttcagccaatg
gcggtaatcactcagcagcaaggcctgccaccgtttacgaccaacagcgacaatggtaaa
actaacggggatggggcagtgggtttttctgcggcattattgccctttttagccagcagc
ccagaaccgtttaatcagcaaacactgaatctccaacagcgacgggtacaaaattcaccg
cctggcgctgatgattattacagtgctattctgaccctgtttggtcaggggtggttacag
catcgttatcattttacccatcagggagagctacagccctcatggcaccgtcaacgttaa

DBGET integrated database retrieval system