KEGG   Yersinia pestis D106004: YPD4_3517Help
Entry
YPD4_3517         CDS       T01832                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ypd  Yersinia pestis D106004
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ypd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4493235..4494134)
Genome map
AA seq 299 aa AA seqDB search
MFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADILIAYNLLEAGRL
WGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLNPSYLPPQLLARF
SSIDGPWEAMVEVNQRMWLETAPNGFSLDWVVWQKGKGWQPDTIKPDVGSNDAILVYLWA
GMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGAVGFSAALLPFLASS
PEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQGELQPSWHRQR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagcgtttattggcttggacagaaaacaatctggcagccggtgatctcacttcc
cgccttcccgcttggttatgggggcaaaactcacaaaataactgggatattctggaccct
aattcggcctccgatgcggatatcttgattgcctacaacttgctggaggctggcaggtta
tggggtaaccgccgttacctgattatgggtaccttattactgcaacgtattgcgcaagaa
gaagtcatggatattcccggccttggccagatgctattaccgggaaaaattggttttaac
gatgaggatacctggcgtctcaacccaagttatttaccgccacaactactggcacgattt
tcctccatagacgggccttgggaagcgatggtagaagtgaatcagcgtatgtggctggaa
accgcaccaaacggtttttcgctggactgggtggtctggcagaaaggtaaaggctggcag
cccgataccataaaaccggatgtcggcagtaacgatgccattctggtttatctgtgggcg
gggatgctggcaatggacagcccacaaaaagctgaattgattgcgcgttttcagccaatg
gcggtaatcactcagcagcaaggcctgccaccgtttacgaccaacagcgacaatggtaaa
actaacggggatggggcagtgggtttttctgcggcattattgccctttttagccagcagc
ccagaaccgtttaatcagcaaacactgaatctccaacagcgacgggtacaaaattcaccg
cctggcgctgatgattattacagtgctattctgaccctgtttggtcaggggtggttacag
catcgttatcattttacccatcagggagagctacagccctcatggcaccgtcaacgttaa

DBGET integrated database retrieval system