KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0126Help
Entry
YPO0126           CDS       T00063                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPO0126 (malQ)
Enzymes [BR:ype01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     YPO0126 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136483..138579
Genome map
AA seq 698 aa AA seqDB search
MDRKSLDQAATLAGIAASYINAHGKPQATLAETKEQLLAAMGRSLGAHDTQTANTPLPVV
KVFTFGSPMQLPMAGSGDYHWQLQTENGELHQGRISAKKTLTLPASLPLGYHRLILEQDL
QQWQCSIIVAPKRCYEPDALLQGKKLWGACVQLYTLRSEHNWGIGDFGDLKQMLEQVGER
GGSFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDINRVEEFQQSEAAQRWWHQAET
QQALAKSRESEWVDYPLVMQLKLTALRLSFPLFTARKAKDAQVQAFRHFVEQGGSSLHQQ
AVFDALHAHLSEHDPMMWGWPVWPEKYRDGHSSAVADFCREHADEVTFYLWLQWLAASQF
DDCFQSSQQRKMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGL
PPMDPHVMVARAYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGHTADQGAYVKYPV
DDLLAVLALESQRHHCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLYFEHDSENIFRAPQS
YPVQAMATITTHDLPTLRGYWQADDLTLGNKLGLYPDQQILKQLYLDRERAKQGLLEGLH
RYDCVPKKVGHKAALLSMSPVLNRGLQRYVADSASALLGLQPEDWLDMAAPVNIPGTTDE
YPNWRRKLSASLEEIFADSQINRLLKDLDKRRKNVSVG
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaaatcgctcgatcaagcagcaacactggcagggatagctgccagttacatt
aatgcgcatggtaaaccgcaggcgacgttagcggaaaccaaagagcagttgttggcggcc
atggggcgttctcttggtgctcatgacactcagacagcgaatacccctttgccggtcgtt
aaagtgtttacgtttggtagcccgatgcaattgccaatggccggttctggcgattatcac
tggcagttacagactgagaacggtgagctgcatcaggggcgtatcagtgcgaaaaaaacg
ctgacattgccggcctctttgccgctgggttatcaccgtttgatattggaacaagattta
cagcagtggcagtgttcaatcatcgtggcaccgaaacgctgctatgagcctgatgctttg
ctgcagggaaaaaaactgtggggggcttgcgtacaactgtataccctgcgttccgagcat
aattggggtatcggtgactttggtgatttaaagcagatgttagagcaggtcggtgagcgt
ggtgggtcctttatcggtttaaaccctatccatgcgttatatccggccaacccgcatagt
gctagcccttacagcccgtcatcccggcgctggttgaatgtgatttatatcgacatcaat
agggtcgaggagtttcagcaaagtgaagccgcgcagcgttggtggcatcaagctgagacg
caacaggcgttggcaaaaagtcgggagagcgagtgggttgattacccgttagttatgcag
cttaaattgacggctttgcgcttatccttcccactgtttactgcccgtaaagccaaagat
gcacaggtgcaggcatttcggcactttgttgaacaaggcgggagcagtttacatcagcag
gccgtatttgatgccctacatgcgcatttaagtgagcatgatccgatgatgtggggctgg
ccagtgtggccagagaagtaccgtgatggtcatagtagtgcggtggctgatttttgtcgc
gaacacgctgacgaggtgacgttctatctgtggttacagtggttggcagccagtcaattt
gatgactgcttccaatccagccaacagcggaaaatgccgattggtctgtatcgtgatttg
gcggttggggttgctgaaggtggcgctgaaacctggtgtgaccgcgagttatattgcctg
aaagcatcagtaggtgccccgccagatatcttggggccattaggccagaactgggggcta
ccgccgatggaccctcatgtaatggtcgcgcgcgcgtatcagccttttattgatttactg
cgtgccaatatgaccagttgtggcgcattgcgcatcgaccatgtcatggcattattgcgt
ctgtggtggatcccctacgggcataccgccgatcagggggcttatgtaaaatacccagtg
gatgatttgctggcggtattagcgctggagagtcagcgccaccattgcatggtgattggt
gaagatttaggcacggtaccggtagagattgtgggcaagttacgtgatagcggggtgtat
tcctacaaggtgctctattttgagcatgacagtgagaatatcttccgtgcgccacagtct
tacccggtgcaggcgatggcgaccattacgacccatgatttgccgacactgcgcggttac
tggcaagctgatgatctgactttggggaataagctggggttatatccggatcaacagatt
ttgaagcagctctatcttgacagagagcgagccaaacaagggttattagaagggttacat
cgttacgattgtgtgccgaaaaaagtgggccacaaagcggcactgttatcgatgagccca
gtactgaaccgtggtttgcagcgctatgttgcggatagcgccagtgcattgctggggtta
caaccagaagattggttggatatggcagcaccagtgaatatccccggtaccactgacgag
taccctaactggcggcgtaaattgtcagcgtctctggaagagatatttgccgatagccag
attaatcgtttattgaaagatttggataagcggcgcaaaaacgtttcggttgggtaa

DBGET integrated database retrieval system