KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0424Help
Entry
YPO0424           CDS       T00063                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPO0424
   00500 Starch and sucrose metabolism
    YPO0424
Enzymes [BR:ype01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     YPO0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
443813..444898
Genome map
AA seq 361 aa AA seqDB search
MPINALSKTLLLGLISFAALGEVSAAQYNAVVSAMAQGDEFSSINAALQSAPPDSSPFVI
FLKKGVYTERLEVNRDNVTLKGEERDTTVIGANTAAGMLNPQGTKWGTSGSSTVLVNAAN
FTAENLTIRNDFDFPANQAKAEGDPTKLKDTQAVALLLAEKSDKARFRQVKLEGYQDTLY
SKTGSRSYFTDCDISGHVDFIFGSGVTVFDRCNIIARDRRDISPPYGYITAPSTQNTAPY
GLIVLNSRLTKEPGVPAKSFALGRPWHPTTAFDDGRYADPAAIGQAVFINTVMDDHIYGW
DKMSGKDKQGEKVWFYPQDSRFFEANNQGPGAEINEGRRQLSAEQLKAFTLPMIFPDWTV
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaatgctctgagtaagacactattattaggattgatatcatttgccgcttta
ggtgaagtcagcgcggcacagtacaatgctgtggtttctgccatggcgcagggcgatgag
ttctcttcaattaatgcagcgttacaatcagcaccgccagatagttctccgtttgttatt
ttccttaaaaaaggcgtttataccgaacggcttgaggtcaatcgtgacaatgtgacgctg
aaaggtgaggagcgtgatacgacggtgattggcgcgaataccgccgcgggtatgctcaac
ccacaagggacgaagtggggaacctctggcagcagcacggtattggtgaatgccgccaat
tttactgcagaaaatttgacgattcgtaatgacttcgatttccctgctaatcaggcgaaa
gcagagggtgatccgacgaaattaaaagatacgcaggcggtggcgctgttattagcagaa
aaaagtgataaagcccgtttcaggcaagtcaaacttgaggggtaccaagatacgctttat
agcaaaacgggcagtcgtagctactttaccgattgtgacatcagtggccacgtcgatttt
atttttggctcaggggtgacggtatttgaccgctgcaatattattgcccgtgatcgccgt
gatatctccccaccttacggttacattacggcacccagtacccaaaataccgcaccttat
ggtctgattgtcctcaatagtcgtttaaccaaagaaccaggtgtgcctgctaaaagtttt
gccttagggcgcccgtggcaccctactacagcatttgatgatggccgttatgctgatcct
gcggctatcggacaggcggtatttatcaataccgtaatggatgatcatatttatggctgg
gataaaatgtctggaaaagataagcaaggcgagaaagtttggttctacccgcaagactct
cgcttctttgaagcgaacaatcagggaccaggggctgaaattaatgaggggcggcgtcag
ttgtctgctgagcaactaaaagcgttcacattgccaatgatttttccagactggaccgtt
cagtaa

DBGET integrated database retrieval system